HHsearch alignment for GI: 254780916 and conserved domain: PRK05342

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional.
Probab=98.54  E-value=1.2e-07  Score=73.59  Aligned_cols=91  Identities=20%  Similarity=0.280  Sum_probs=66.0

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-----CCHHHHHCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             32048873277743679999998426754332101234655421-----0024331125555322111001234466714
Q gi|254780916|r  162 CAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQD-----KIEKFLFGDVDLQTKNSAQFLGKFIEANGGT  236 (482)
Q Consensus       162 ~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~-----~~e~~lFG~~~~~~~~~~~~~g~~~~a~~Gt  236 (482)
T Consensus       108 ~KsNILliGPTG~GKTlla~tLAk~---l~vPF~iaDAT~lTEaGYVGeDVE~ii~~Llq-------~Ad~dve~Ae~GI  177 (411)
T PRK05342        108 QKSNILLIGPTGSGKTLLAQTLARI---LNVPFAIADATTLTEAGYVGEDVENILLKLLQ-------AADYDVEKAQRGI  177 (411)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHH---HCCCEEEEEECEECCCCCCCCCHHHHHHHHHH-------HCCCCHHHHHCCE
T ss_conf             3453899899997788999999998---69998998612001267456079999999999-------8288899883682


Q ss_pred             EEECCCCHHHH--------------HHHHHHHHHHHHHHC
Q ss_conf             75166420018--------------899988887764200
Q gi|254780916|r  237 IVLEEPDALPL--------------AVQGRIYNFIETGKI  262 (482)
Q Consensus       237 l~l~ei~~L~~--------------~~Q~~Ll~~l~~~~~  262 (482)
T Consensus       178 V~IDEIDKIarks~~~s~trDVSgEGVQqaLLkiiEGt~v  217 (411)
T PRK05342        178 VYIDEIDKIARKSENPSITRDVSGEGVQQALLKILEGTVA  217 (411)
T ss_pred             EEEEEHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCEE
T ss_conf             8885023454247888887776512489999998758714