HHsearch alignment for GI: 254780916 and conserved domain: PRK05896

>PRK05896 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.01  E-value=5.9e-05  Score=54.67  Aligned_cols=209  Identities=15%  Similarity=0.168  Sum_probs=117.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHC----CCCCCCCCC-CCCCCCCCC----C
Q ss_conf             1111111122222222222222223443204887327774367999999842----675433210-123465542----1
Q gi|254780916|r  135 EHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHES----GKRAFFPFF-IVNCGMIDQ----D  205 (482)
Q Consensus       135 ~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~----s~r~~~~fi-~v~c~~~~~----~  205 (482)
T Consensus        11 RPk~F~eIIGQe~iv~~L~nAI~~~-RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~dpCg~C~sC~~I~~g~h~D   89 (613)
T PRK05896         11 RPHNFKQIIGQELIKKILVNAILNN-KLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGDCCNSCSVCESINTNQSVD   89 (613)
T ss_pred             CCCCHHHHCCCHHHHHHHHHHHHCC-CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCC
T ss_conf             7997655238299999999999849-976227755899848899999999996699999999888887899985699998


Q ss_pred             CCHHHHHCCCCCCCC-CCCCCCCCCCC-------CCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEE
Q ss_conf             002433112555532-21110012344-------6671475166420018899988887764200112355321234315
Q gi|254780916|r  206 KIEKFLFGDVDLQTK-NSAQFLGKFIE-------ANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRL  277 (482)
Q Consensus       206 ~~e~~lFG~~~~~~~-~~~~~~g~~~~-------a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~Ri  277 (482)
T Consensus        90 viE------Idaasn~gIDeIReLie~~~~~P~~gkyKV~IIDEah~Ln~~AaNALLKtLEEP-----------P~~viF  152 (613)
T PRK05896         90 IVE------LDAASNNGVDEIRNIIDNINYLPTTFKYKVYIIDEAHMLSTSAWNALLKTLEEP-----------PKHVVF  152 (613)
T ss_pred             EEE------EECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHCCHHHHHHHHHHCCCC-----------CCCCEE
T ss_conf             688------406555788999999997085875799459998162217999999999853489-----------878379


Q ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6521433211111123337999886543344677877442-------222556677764101122333321111100012
Q gi|254780916|r  278 IFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSE-------DIPWLVHFFLQSFCTKNAIKQISISDKALSLLT  350 (482)
Q Consensus       278 Ia~t~~~L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~e-------DI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~  350 (482)
T Consensus       153 IL~Ttep-~K--------------------LLpTIlSRCQrf~Fkri~~~~I~~~-L~~I~~kE~---i~ie~~AL~~Ia  207 (613)
T PRK05896        153 IFATTEF-QK--------------------IPLTIISRCQRYNFKKLNNSELQEL-LKSIAKKEK---IKIEDNAIDKIA  207 (613)
T ss_pred             EEEECCH-HH--------------------CCHHHHHCCCCEECCCCCHHHHHHH-HHHHHHHCC---CCCCHHHHHHHH
T ss_conf             9982881-54--------------------9376640355001788998999999-999999739---987899999999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCC
Q ss_conf             23389868999999999987438981068895454212
Q gi|254780916|r  351 KYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSR  388 (482)
Q Consensus       351 ~y~WPGNvREL~n~i~r~~i~~~~~~i~~~~~~~~l~~  388 (482)
T Consensus       208 ~~a-dGs~RDAlslLdQ~~~~-~~~~it~~~v~~~~g~  243 (613)
T PRK05896        208 DLA-DGSLRDGLSILDQLSTF-KNKKIDIEDINKTFGL  243 (613)
T ss_pred             HHC-CCCHHHHHHHHHHHHHH-CCCCCCHHHHHHHHCC
T ss_conf             976-88487898899999983-5688629999999677