HHsearch alignment for GI: 254780916 and conserved domain: PRK06305

>PRK06305 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.33  E-value=5.7e-06  Score=61.83  Aligned_cols=219  Identities=15%  Similarity=0.150  Sum_probs=125.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCC----CCC-CCCC-CCCCCCCCC---
Q ss_conf             2111111112222222222222222344320488732777436799999984267----543-3210-123465542---
Q gi|254780916|r  134 NEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGK----RAF-FPFF-IVNCGMIDQ---  204 (482)
Q Consensus       134 ~~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~----r~~-~~fi-~v~c~~~~~---  204 (482)
T Consensus        11 YRP~~F~dvVGQ~~vv~~L~nai~~-~ri~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~~pCg~C~~C~~I~~g~~   89 (462)
T PRK06305         11 YRPQTFSEILGQDAVVTVLKNALRF-NRAAHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQEPCNQCAICKEISSGTS   89 (462)
T ss_pred             HCCCCHHHHCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             3889876604909999999999984-997623430389985999999999999679999888898876688899863899


Q ss_pred             -CCCHHHHHCCCCCCC--CCCCCCC----CCCCCCC--CCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             -100243311255553--2211100----1234466--714751664200188999888877642001123553212343
Q gi|254780916|r  205 -DKIEKFLFGDVDLQT--KNSAQFL----GKFIEAN--GGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDV  275 (482)
Q Consensus       205 -~~~e~~lFG~~~~~~--~~~~~~~----g~~~~a~--~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~  275 (482)
T Consensus        90 ~DViE------iDaAs~~gVddIRel~e~v~~~P~~~~yKVyIIDEvhmLs~~AfNALLKtLEEP-----------P~~v  152 (462)
T PRK06305         90 LDVIE------IDGASHRGIEDIRQINETVLFTPSKSQYKIYIIDEVHMLTKEAFNSLLKTLEEP-----------PQHV  152 (462)
T ss_pred             CCEEE------ECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECHHHCCHHHHHHHHHHHHCC-----------CCCE
T ss_conf             98686------435534466899999977100886775059998152117999999999986189-----------8774


Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             15652143321111112333799988654334467787744222255667776410112233332111110001223389
Q gi|254780916|r  276 RLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWI  355 (482)
Q Consensus       276 RiIa~t~~~L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WP  355 (482)
T Consensus       153 ~FILaTTe~-~KIp~T------IlSR--CQrf~F~~i~--~~~I---~~~-L~~I~~~E~---i~~e~~AL~lIA~~a-~  213 (462)
T PRK06305        153 KFFLATTEI-HKIPGT------ILSR--CQKMHLKRIP--EETI---IDK-LALIAQQDG---IETSREALLPIARAA-Q  213 (462)
T ss_pred             EEEEEECCH-HHCCHH------HHHH--HHEEECCCCC--HHHH---HHH-HHHHHHHCC---CCCCHHHHHHHHHHC-C
T ss_conf             999981881-428547------8765--4023325799--9999---999-999999839---985999999999985-8


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCC
Q ss_conf             86899999999998743898106889545421244
Q gi|254780916|r  356 DNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREG  390 (482)
Q Consensus       356 GNvREL~n~i~r~~i~~~~~~i~~~~~~~~l~~~~  390 (482)
T Consensus       214 GsmRDAlslLDQ~i~~-~~~~it~~~V~~~lG~v~  247 (462)
T PRK06305        214 GSLRDAESLYDYVVGL-FPKSLSPDTVAKALGLLS  247 (462)
T ss_pred             CCHHHHHHHHHHHHHH-CCCCCCHHHHHHHHCCCC
T ss_conf             9587899999999984-799868999999868998