HHsearch alignment for GI: 254780916 and conserved domain: PRK06526

>PRK06526 transposase; Provisional.
Probab=97.55  E-value=6.3e-05  Score=54.46  Aligned_cols=111  Identities=13%  Similarity=0.094  Sum_probs=65.0

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             22344320488732777436799999984267543321012346554210024331125555322111001234466714
Q gi|254780916|r  157 RKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGT  236 (482)
Q Consensus       157 ~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a~~Gt  236 (482)
T Consensus        92 ~~fi~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~~~L~~~L~~a----~~---~g~~~~~~~~l~~~d--L  162 (254)
T PRK06526         92 LDFVTGKENVVFLGPPGTGKTHLAIGLGIRACQAGHRVLFATAAQWVARLAAA----HH---AGRLQDELVKLGRIP--L  162 (254)
T ss_pred             CCHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHH----HH---CCCHHHHHHHHHCCC--E
T ss_conf             71776588789989999868999999999999869967998779999999998----85---580999999851368--7


Q ss_pred             EEECCCCHHHHHHH--HHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCC
Q ss_conf             75166420018899--9888877642001123553212343156521433211
Q gi|254780916|r  237 IVLEEPDALPLAVQ--GRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLP  287 (482)
Q Consensus       237 l~l~ei~~L~~~~Q--~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~  287 (482)
T Consensus       163 LIiDe~g~~~~~~~~a~~lf~li~~R-ye~-------~---S~IiTSn~~~~~  204 (254)
T PRK06526        163 LIVDEVGYIPFEAEAANLFFQLVSSR-YER-------A---SLIVTSNKPFGR  204 (254)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHH-HCC-------C---CEEEECCCCHHH
T ss_conf             76502136447889999999999999-745-------8---867665898668