HHsearch alignment for GI: 254780916 and conserved domain: PRK06871

>PRK06871 DNA polymerase III subunit delta'; Validated.
Probab=93.85  E-value=0.46  Score=27.18  Aligned_cols=96  Identities=14%  Similarity=0.136  Sum_probs=49.3

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC------C----CCCCCHHHHHCCCCCCC-CCCCCC--CC
Q ss_conf             43204887327774367999999842675433210123465------5----42100243311255553-221110--01
Q gi|254780916|r  161 DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGM------I----DQDKIEKFLFGDVDLQT-KNSAQF--LG  227 (482)
Q Consensus       161 ~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~------~----~~~~~e~~lFG~~~~~~-~~~~~~--~g  227 (482)
T Consensus        21 r~~HA~L~~G~~G~Gk~~la~~~a~~ll-C~~~~~~~~Cg~C~sC~l~~~g~HPD~~~---i~~~~~k~I~vd~IR~l~~   96 (324)
T PRK06871         21 RGHHALLFKADSGLGTEQLIRALAQWLM-CQAPGDEQPCGQCHSCHLFQAGNHPDFHI---LEPIDGKDIGVDQVREINE   96 (324)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHH-CCCCCCCCCCCCCHHHHHHHCCCCCCEEE---EECCCCCCCCHHHHHHHHH
T ss_conf             9543787689999789999999999982-89999999888898999997389998799---8467888788999999999


Q ss_pred             CC----CCCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             23----4466714751664200188999888877642
Q gi|254780916|r  228 KF----IEANGGTIVLEEPDALPLAVQGRIYNFIETG  260 (482)
Q Consensus       228 ~~----~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~  260 (482)
T Consensus        97 ~~~~~~~~g~~KV~iI~~ae~m~~~AaNALLKtLEEP  133 (324)
T PRK06871         97 KVSQFAQQGGNKVVYIQGAERLTEAAANALLKTLEEP  133 (324)
T ss_pred             HHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHHCCC
T ss_conf             9864622059669997588885799999999983389