HHsearch alignment for GI: 254780916 and conserved domain: PRK07133

>PRK07133 DNA polymerase III subunits gamma and tau; Validated.
Probab=97.96  E-value=5.5e-05  Score=54.89  Aligned_cols=209  Identities=16%  Similarity=0.196  Sum_probs=112.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCC---CCCC--CCCCCCCCCC---CCCCC
Q ss_conf             11111111222222222222222234432048873277743679999998426---7543--3210123465---54210
Q gi|254780916|r  135 EHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESG---KRAF--FPFFIVNCGM---IDQDK  206 (482)
Q Consensus       135 ~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s---~r~~--~~fi~v~c~~---~~~~~  206 (482)
T Consensus        13 RPk~F~EVIGQe~Vv~tL~nAI~~-gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~~p--C~~C~~~~~~s~DV   89 (718)
T PRK07133         13 RPKKFDEIKGQDHIIETLKNIIKS-GKISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLIEP--CQNCIENFNNNLDI   89 (718)
T ss_pred             CCCCHHHHCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHCCCCCCCE
T ss_conf             899754422859999999999974-997505862389986889999999999679999999997--70214304789873


Q ss_pred             CHHHHHCCCCCCCC-CCCCCCCCCCC-----CCC--CEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEE
Q ss_conf             02433112555532-21110012344-----667--14751664200188999888877642001123553212343156
Q gi|254780916|r  207 IEKFLFGDVDLQTK-NSAQFLGKFIE-----ANG--GTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLI  278 (482)
Q Consensus       207 ~e~~lFG~~~~~~~-~~~~~~g~~~~-----a~~--Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiI  278 (482)
T Consensus        90 iE------IDAASn~gVDdIReLie~v~y~P~~gkYKVyIIDEvHMLS~~AfNALLKtLEEP-----------P~hvvFI  152 (718)
T PRK07133         90 IE------MDAASNNGVDEIRELRENVKNLPQISKYKIYIIDEVHMLSKSAFNALLKTLEEP-----------PKHVIFI  152 (718)
T ss_pred             EE------ECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCC-----------CCCCEEE
T ss_conf             77------545566888999999998255887787249999662007999999999850279-----------8782799


Q ss_pred             EECCCCC----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5214332----111111233379998865433446778774422225566777641011223333211111000122338
Q gi|254780916|r  279 FLTEKNL----LPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPW  354 (482)
Q Consensus       279 a~t~~~L----~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~W  354 (482)
T Consensus       153 LaTTep~KIP~TIlSRCQrF-------------dF-----krI~~~~I~~~-L~~I~~kE~---I~~e~eAL~lIA~~a-  209 (718)
T PRK07133        153 LATTDVQKIPLTILSRVQRF-------------NF-----RRISEDVIVHQ-LENILEKEK---IKYEKNALKLIASLA-  209 (718)
T ss_pred             EEECCHHHCCHHHHHCCEEE-------------EC-----CCCCHHHHHHH-HHHHHHHCC---CCCCHHHHHHHHHHC-
T ss_conf             97088254848774122033-------------58-----88999999999-999999859---977899999999976-


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHC
Q ss_conf             986899999999998743898106889545421
Q gi|254780916|r  355 IDNVQELKNILLRAVIGLKDSHLTEDRFVLLLS  387 (482)
Q Consensus       355 PGNvREL~n~i~r~~i~~~~~~i~~~~~~~~l~  387 (482)
T Consensus       210 ~GSmRDAlSlLDQv~~f~-ng~it~k~v~~~~G  241 (718)
T PRK07133        210 SGSLRDALSIADQVSIFG-NGNITLKNVNELFG  241 (718)
T ss_pred             CCCHHHHHHHHHHHHHHC-CCCCCHHHHHHHHC
T ss_conf             884888987999999854-89872999999967