HHsearch alignment for GI: 254780916 and conserved domain: PRK08939

>PRK08939 primosomal protein DnaI; Reviewed.
Probab=96.34  E-value=0.0033  Score=42.25  Aligned_cols=124  Identities=16%  Similarity=0.176  Sum_probs=72.2

Q ss_pred             CCCCCCCCCCCCCC--CCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCC--CC
Q ss_conf             22222222222234--432048873277743679999998426754332101234655421002433112555532--21
Q gi|254780916|r  147 PAMIQVVDLARKAG--DCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTK--NS  222 (482)
Q Consensus       147 ~~m~~v~~~i~~~a--~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~--~~  222 (482)
T Consensus       139 ~a~~~a~~F~~~y~~~~~~kGlyl~G~~G~GKTyL~~aian~La~~g~~v~~v~~p~----~~-~~l----K~s~~d~s~  209 (306)
T PRK08939        139 DALMAALDFLEAYKPGEKVKGLYLYGDFGVGKTYLLAAIANELAKKGVSSTLVHFPE----FI-REL----KNAISDGSV  209 (306)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH----HH-HHH----HHHHCCCCH
T ss_conf             999999999997376988877889899999899999999999998699299987599----99-999----998648988


Q ss_pred             CCCCCCCCCCCCCEEEECCCCH--HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             1100123446671475166420--0188999888877642001123553212343156521433211111
Q gi|254780916|r  223 AQFLGKFIEANGGTIVLEEPDA--LPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVK  290 (482)
Q Consensus       223 ~~~~g~~~~a~~Gtl~l~ei~~--L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~  290 (482)
T Consensus       210 ~~~i~~~k~~--~vLiLDDiGaE~~t~W~rd~vl~~IL~~Rm~---~~lP------TffTSN~~~~eLe~  268 (306)
T PRK08939        210 KEKIDAVKEA--PVLMLDDIGAEQMSSWVRDEVLGVILQYRMQ---EELP------TFFTSNFDFDELEH  268 (306)
T ss_pred             HHHHHHHHCC--CEEEEECCCCCCCCHHHHHHHHHHHHHHHHH---CCCC------EEEECCCCHHHHHH
T ss_conf             9999998449--9899844465426777899899999999997---4999------79977999999999