HHsearch alignment for GI: 254780916 and conserved domain: PRK09087

>PRK09087 hypothetical protein; Validated.
Probab=98.03  E-value=3.6e-05  Score=56.19  Aligned_cols=199  Identities=17%  Similarity=0.186  Sum_probs=116.0

Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCCCCCCEE-EEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             11111111-22222222222222223443204-88732777436799999984267543321012346554210024331
Q gi|254780916|r  135 EHCALDSL-IAVSPAMIQVVDLARKAGDCAIP-IMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLF  212 (482)
Q Consensus       135 ~~~~~~~L-iG~S~~m~~v~~~i~~~a~~~~~-vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lF  212 (482)
T Consensus        16 ~~~~~dnF~vs~~N--~~a~~~l~~~~~w~~~~~~L~Gp~gsGKTHL~~~~~~~~~---a~--~~~~~~~~~~~~-----   83 (226)
T PRK09087         16 PGYGRDDLVVTESN--RAAVSLVDRWPNWPSPVVVLAGPVGSGKTHLASIWREKAD---AL--LVHPNEIGSDAA-----   83 (226)
T ss_pred             CCCCCCCEEECCCH--HHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC---CE--EECHHHCCHHHH-----
T ss_conf             77873364775769--9999999847267777589989999988699999999809---96--836687474667-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHH
Q ss_conf             12555532211100123446671475166420018899988887764200112355321234315652143321111112
Q gi|254780916|r  213 GDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSH  292 (482)
Q Consensus       213 G~~~~~~~~~~~~~g~~~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g  292 (482)
T Consensus        84 -----------------~~~~~~~~~idd~d~~~~d-Ee~LFhl~N~~----------~~~~~~LLlts~~~p~~l~~~-  134 (226)
T PRK09087         84 -----------------NAAAERPVLIEDIDAGGFD-ETGLFHLINSV----------RQAGTSLLMTSRLWPSAWNVK-  134 (226)
T ss_pred             -----------------HHHCCCCEEEECCCCCCCC-HHHHHHHHHHH----------HHCCCEEEEECCCCHHHCCCC-
T ss_conf             -----------------6532798899748777747-89999999999----------853987999889895666762-


Q ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--
Q ss_conf             3337999886543-3446778774422225566777641011223333211111000122338986899999999998--
Q gi|254780916|r  293 VFRKDLYYRISVF-LINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAV--  369 (482)
Q Consensus       293 ~fr~dLy~rL~~~-~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~r~~--  369 (482)
T Consensus       135 --L~DL~SRL~~~~~~~I~~pd----D~--ll~~~L~k~~~~r~---l~l~~~v~~yll~r-~~Rs~~~l~~~l~~LD~~  202 (226)
T PRK09087        135 --LPDLKSRLKAATVVEIGEPD----DA--LLSGVIFKLFADRQ---LYVEPHVVYYLVSR-MERSLFAAQTIVERLDRL  202 (226)
T ss_pred             --CHHHHHHHHCCEEEEECCCC----HH--HHHHHHHHHHHHCC---CCCCHHHHHHHHHH-CCCCHHHHHHHHHHHHHH
T ss_conf             --46899998578579835999----89--99999999987576---57888899999984-588999999999999999


Q ss_pred             HHCCCCCCCHHHHHHHH
Q ss_conf             74389810688954542
Q gi|254780916|r  370 IGLKDSHLTEDRFVLLL  386 (482)
Q Consensus       370 i~~~~~~i~~~~~~~~l  386 (482)
T Consensus       203 SL~~kr~ITiplikevL  219 (226)
T PRK09087        203 ALERKSRITRALAAEVL  219 (226)
T ss_pred             HHHCCCCCCHHHHHHHH
T ss_conf             99818999899999999