HHsearch alignment for GI: 254780916 and conserved domain: PRK09390

>PRK09390 fixJ response regulator FixJ; Provisional.
Probab=99.87  E-value=1e-21  Score=173.12  Aligned_cols=118  Identities=15%  Similarity=0.205  Sum_probs=109.4

Q ss_pred             CCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCH--HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             28838998699899999999999889889998937--9999860899899997854698889999999985789839999
Q gi|254780916|r    9 RHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVS--DLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQ   86 (482)
Q Consensus         9 ~~~rILIVDDd~~~~~~l~~~L~~~G~~v~~a~~~--al~~l~~~~~dlillD~~mP~~dGlell~~i~~~~p~ipvIii   86 (482)
T Consensus         2 ~k~tIliVDDh~~vr~gl~~lL~~~~~~v~~~~~~~~~l~~~~~~~pdlvllDi~mP~~~G~e~l~~l~~~~p~~~vivl   81 (202)
T PRK09390          2 TKGVVHVVDDDEAMRDSLAFLLDSAGFEVRLFESAQAFLDALPGLRFGCVVTDVRMPGIDGIELLRRLKARGSPLPVIVM   81 (202)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHCCCCCCEEEE
T ss_conf             99979998499999999999999889989998999999999765797999877999998960799998722899867999


Q ss_pred             ECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2689999999888505743222222222222222222222
Q gi|254780916|r   87 TTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALRE  126 (482)
Q Consensus        87 T~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~  126 (482)
T Consensus        82 T~~~~~~~~~~al~~GA~gyl~K~~~~~~L~~aI~~~l~~  121 (202)
T PRK09390         82 TGHGDVPLAVEAMKLGAIDFIEKPFEDERLIGAIERALAQ  121 (202)
T ss_pred             EECCCHHHHHHHHHCCCHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             7457488889999829464455999999999999999971