HHsearch alignment for GI: 254780916 and conserved domain: PRK09581

>PRK09581 pleD response regulator PleD; Reviewed.
Probab=99.90  E-value=5.3e-23  Score=182.17  Aligned_cols=116  Identities=15%  Similarity=0.226  Sum_probs=106.5

Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCH--HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
Q ss_conf             8838998699899999999999889889998937--9999860899899997854698889999999985--78983999
Q gi|254780916|r   10 HKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVS--DLSTISKIQVNVIFLSLINCEDDKENILKNIVDK--IPIVPIIV   85 (482)
Q Consensus        10 ~~rILIVDDd~~~~~~l~~~L~~~G~~v~~a~~~--al~~l~~~~~dlillD~~mP~~dGlell~~i~~~--~p~ipvIi   85 (482)
T Consensus         2 ~~rILiVdD~~~~~~~l~~~L~~~~y~v~~a~~G~eAL~~~~~~~PDLILlDi~MP~mdG~ev~r~Lk~~~~~~~iPVIv   81 (457)
T PRK09581          2 TARILVVDDIPANVKLLEAKLLAEYYTVLTASSGAEAIEICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATAHIPVVM   81 (457)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEEE
T ss_conf             97199994989999999999987899999989999999999718999899928779999999999996598889984999


Q ss_pred             EECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9268999999988850574322222222222222222222
Q gi|254780916|r   86 QTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALR  125 (482)
Q Consensus        86 iT~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~  125 (482)
T Consensus        82 lTa~~d~e~~~~al~~GA~DYL~KP~~~~~L~~ri~~l~r  121 (457)
T PRK09581         82 VTALDDPSDRVRGLEAGADDFLTKPINDVALFARVKSLTR  121 (457)
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             9789999999999864887899899998999999999998