HHsearch alignment for GI: 254780916 and conserved domain: PRK10923

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional.
Probab=100.00  E-value=0  Score=888.04  Aligned_cols=461  Identities=23%  Similarity=0.345  Sum_probs=410.3

Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCEEEEECC--HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             883899869989999999999988988999893--799998608998999978546988899999999857898399992
Q gi|254780916|r   10 HKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNV--SDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQT   87 (482)
Q Consensus        10 ~~rILIVDDd~~~~~~l~~~L~~~G~~v~~a~~--~al~~l~~~~~dlillD~~mP~~dGlell~~i~~~~p~ipvIiiT   87 (482)
T Consensus         3 k~kILiVDDd~~~r~~l~~~L~~~g~~v~~a~~~~~al~~l~~~~~dlvl~Di~mP~~~Gl~ll~~lr~~~~~~pvIviT   82 (469)
T PRK10923          3 RGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMT   82 (469)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             99799994989999999999987799899989999999998669999998789999989999999998429899789998


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             6899999998885057432222222222222222222222222---2222111111112222222222222222344320
Q gi|254780916|r   88 TQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVP---SQENEHCALDSLIAVSPAMIQVVDLARKAGDCAI  164 (482)
Q Consensus        88 ~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~~~---~~~~~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~  164 (482)
T Consensus        83 ~~~~~~~av~A~~~GA~dyL~KP~~~~~L~~~v~ral~~~~~~~~~~~~~~~~~~~~liG~S~~m~~v~~~i~~~a~~~~  162 (469)
T PRK10923         83 AHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNIQVNGPTTDIIGEAPAMQDVFRIIGRLSRSSI  162 (469)
T ss_pred             CCCCHHHHHHHHHCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHHHHHCCCC
T ss_conf             99998999999855704430088999999999999999999986544312106755654689999999999999858899


Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCC-CCCCCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             48873277743679999998426754332101234655421002433112555-53221110012344667147516642
Q gi|254780916|r  165 PIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDL-QTKNSAQFLGKFIEANGGTIVLEEPD  243 (482)
Q Consensus       165 ~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~-~~~~~~~~~g~~~~a~~Gtl~l~ei~  243 (482)
T Consensus       163 pVLI~GE~GTGK~~~Ar~IH~~S~r~~~pfi~vnC~~~~~~~~e~eLFG~~~gaf~ga~~~~~g~~e~a~~GTLfLdeI~  242 (469)
T PRK10923        163 SVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDEIG  242 (469)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHCCCCCEEHHHHH
T ss_conf             78998989826999999999748877999578767889977899997087667878864245873664389926566366


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00188999888877642001123553212343156521433211111123337999886543344677877442222556
Q gi|254780916|r  244 ALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLV  323 (482)
Q Consensus       244 ~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~  323 (482)
T Consensus       243 ~L~~~~Q~kLl~~L~~~~~~~~g~~~~~~~d~RiIaat~~~L~~~v~~g~Fr~dLyyrL~~~~I~lPpLReR~eDI~~L~  322 (469)
T PRK10923        243 DMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLA  322 (469)
T ss_pred             HCCHHHHHHHHHHHHCCCEEECCCCCEEEECCEEEEECCCCHHHHHHHCCHHHHHHHHHHHHCCCCCCHHHCHHHHHHHH
T ss_conf             48999999999998559378579985122143799707879999866081779999864424015846544653499999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             67776410112233332111110001223389868999999999987438981068895454212445432234322222
Q gi|254780916|r  324 HFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACT  403 (482)
Q Consensus       324 ~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~r~~i~~~~~~i~~~~~~~~l~~~~~~~~~~~~~~~~~  403 (482)
T Consensus       323 ~~fl~~~~~~~~~~~~~~s~~a~~~L~~y~WPGNvrEL~n~ier~~~~~~~~~i~~~dl~~~l~~~~~~~~~~~------  396 (469)
T PRK10923        323 RHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQLENTCRWLTVMAAGQEVLIQDLPGELFESTVPDSTSQ------  396 (469)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHCCHHHHHCCCCCCCCC------
T ss_conf             99999999985999787899999999749999879999999999998579982547757298863337776545------


Q ss_pred             CCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHHHCCC
Q ss_conf             233444321000000001123444543258999999999999999828727899978489988999999981888
Q gi|254780916|r  404 CYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIE  478 (482)
Q Consensus       404 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~E~~~I~~aL~~~~Gn~~~aA~~LGIsR~tL~rKlk~~gi~  478 (482)
T Consensus       397 --~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~Er~~I~~aL~~~~gn~~~aA~~LGisR~TLyrKlkk~gi~  469 (469)
T PRK10923        397 --MQPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME  469 (469)
T ss_pred             --CCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHHHCCC
T ss_conf             --5774034442110011111342015899999999999999999909989999999898999999999986839