HHsearch alignment for GI: 254780916 and conserved domain: PRK11034

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional.
Probab=99.36  E-value=3.3e-12  Score=105.95  Aligned_cols=342  Identities=13%  Similarity=0.153  Sum_probs=210.8

Q ss_pred             CCEEEECCCHH-------------HHHHHHHHHHHCCCEEEEECC-HHHHH-HH-----CCCCCEEEEECCCCC-CCHHH
Q ss_conf             83899869989-------------999999999988988999893-79999-86-----089989999785469-88899
Q gi|254780916|r   11 KRVLIIDKDDE-------------QIKIIKDHVESYGYDVFIVNV-SDLST-IS-----KIQVNVIFLSLINCE-DDKEN   69 (482)
Q Consensus        11 ~rILIVDDd~~-------------~~~~l~~~L~~~G~~v~~a~~-~al~~-l~-----~~~~dlillD~~mP~-~dGle   69 (482)
T Consensus       279 ~~ILFIDEiH~ivGaG~~~gg~~DaaNlLKP~LarG~l~~IgaTT~~EYrk~iekD~AL~RRFq~V~V~--EPs~e~t~~  356 (758)
T PRK11034        279 NSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDIT--EPSIEETVQ  356 (758)
T ss_pred             CEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCHHHHHCCCEEECC--CCCHHHHHH
T ss_conf             859998043442268876777646788745787469723999437799875032147888428265318--999899999


Q ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----------C---------
Q ss_conf             999999857898399992689999999888505743222222222222222222222222----------2---------
Q gi|254780916|r   70 ILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVV----------P---------  130 (482)
Q Consensus        70 ll~~i~~~~p~ipvIiiT~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~~----------~---------  130 (482)
T Consensus       357 IL~gl~~~yE~~H~v~~~-d~al~~av~Ls~rYi~d----r~lPDKAIdllDea~a~~~l~~~~~~~~~v~~~di~~vv~  431 (758)
T PRK11034        357 IINGLKPKYEAHHDVRYT-AKAVRAAVELAVKYIND----RHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVA  431 (758)
T ss_pred             HHHHHHHHHHHCCCCEEC-CHHHHHHHHHHHHHHCC----CCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCHHHHHHHHH
T ss_conf             999899987323695774-38999999999765026----8896199999999988875134566316589999999998


Q ss_pred             -----------CCCC------CCCCCCCCCCCCCCCCCCCCCCCCCC----CCCEEE---EEECCCCCHHHHHHHHHHHC
Q ss_conf             -----------2222------11111111222222222222222234----432048---87327774367999999842
Q gi|254780916|r  131 -----------SQEN------EHCALDSLIAVSPAMIQVVDLARKAG----DCAIPI---MIQGEFGVGKKRLSRFIHES  186 (482)
Q Consensus       131 -----------~~~~------~~~~~~~LiG~S~~m~~v~~~i~~~a----~~~~~v---li~Ge~GtGK~~~A~~iH~~  186 (482)
T Consensus       432 ~~t~ip~~~~~~~~~~~l~~le~~l~~~viGQ~~Ai~~v~~ai~~~raGL~~~~rPigsFlf~GPTGVGKTElak~LA~~  511 (758)
T PRK11034        432 RIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKA  511 (758)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             75036076776779999998999987787454999999999999986388899997058999789987779999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCC----CCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6754332101234655421002433112555532211100123----446671475166420018899988887764200
Q gi|254780916|r  187 GKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKF----IEANGGTIVLEEPDALPLAVQGRIYNFIETGKI  262 (482)
Q Consensus       187 s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~~~~~g~~----~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~  262 (482)
T Consensus       512 L---~~~lir~DMSEy~e~hsvsrLiGaPPGYVGy~e--GG~Lte~Vr~~PysVvL~DEIEKAhpdV~nilLQvlD~G~L  586 (758)
T PRK11034        512 L---GIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQ--GGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLLLQVMDNGTL  586 (758)
T ss_pred             H---HHHHHCCCHHHHCCHHHHHHHCCCCCCCCCCCC--CCCCCHHHHHCCCEEEEEHHHHHHCHHHHHHHHHHCCCCCC
T ss_conf             8---667721426653120147774489986667677--77012878739877997336756398999988732377830


Q ss_pred             CCCCCCCCCCCCCE---EEEECCCCCCCC----------------C--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11235532123431---565214332111----------------1--11233379998865433446778774422225
Q gi|254780916|r  263 EFFDSRGAIRLDVR---LIFLTEKNLLPQ----------------V--KSHVFRKDLYYRISVFLINISTLRSRSEDIPW  321 (482)
Q Consensus       263 ~~~g~~~~~~~~~R---iIa~t~~~L~~~----------------~--~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~  321 (482)
T Consensus       587 t---D~~Gr~vdF~NtiIImTSN~Ga~~~~~~~~gf~~~~~~~~~~~~l~~~F~PEFlNRiD~ii-~F~~L~~--~~l~~  660 (758)
T PRK11034        587 T---DNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNII-WFDHLST--DVIHQ  660 (758)
T ss_pred             C---CCCCCEEECEEEEEEEECCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHCCHHHHHHCCEEE-EECCCCH--HHHHH
T ss_conf             1---7999988440019998256174878642147554203599999999547986772367478-6388999--99999


Q ss_pred             HHHHHHHHHCCCCCCC--CCCCCCCCCCCCCCCCCC--CCHHHHHHHHHHHHH
Q ss_conf             5667776410112233--332111110001223389--868999999999987
Q gi|254780916|r  322 LVHFFLQSFCTKNAIK--QISISDKALSLLTKYPWI--DNVQELKNILLRAVI  370 (482)
Q Consensus       322 L~~~fl~~~~~~~~~~--~~~ls~~a~~~L~~y~WP--GNvREL~n~i~r~~i  370 (482)
T Consensus       661 Iv~~~l~~l~~rL~~~~i~l~~~~~a~~~l~~~gyd~~~GARpl~R~I~~~i~  713 (758)
T PRK11034        661 VVDKFIVELQAQLDQKGVSLEVSQEARDWLAEKGYDRAMGARPMARVIQDNLK  713 (758)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999999789859988999999998488945371128899999988