HHsearch alignment for GI: 254780916 and conserved domain: PRK11173

>PRK11173 two-component response regulator; Provisional.
Probab=99.87  E-value=1.5e-21  Score=171.95  Aligned_cols=120  Identities=15%  Similarity=0.169  Sum_probs=109.2

Q ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCH--HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEE
Q ss_conf             3528838998699899999999999889889998937--99998608998999978546988899999999857898399
Q gi|254780916|r    7 LDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVS--DLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPII   84 (482)
Q Consensus         7 m~~~~rILIVDDd~~~~~~l~~~L~~~G~~v~~a~~~--al~~l~~~~~dlillD~~mP~~dGlell~~i~~~~p~ipvI   84 (482)
T Consensus         1 m~~-~~ILiVEDD~~~~~~l~~~L~~~G~~V~~a~~~~ea~~~l~~~~~DlvilDi~lp~~~G~~l~~~iR~~~-~~piI   78 (237)
T PRK11173          1 MQT-PHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSENDINLVIMDINLPGKNGLLLARELREQA-NVALM   78 (237)
T ss_pred             CCC-CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHCC-CCCEE
T ss_conf             999-9899995989999999999998899999989999999998638998999938999887303555665168-84789


Q ss_pred             EEECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99268999999988850574322222222222222222222222
Q gi|254780916|r   85 VQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGV  128 (482)
Q Consensus        85 iiT~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~  128 (482)
T Consensus        79 ~lta~~~~~~~i~~l~~GaddYi~KPf~~~EL~arv~~~l~r~~  122 (237)
T PRK11173         79 FLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRTM  122 (237)
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             99432577889999976976788789887999999999986641