HHsearch alignment for GI: 254780916 and conserved domain: PRK13833

>PRK13833 conjugal transfer protein TrbB; Provisional.
Probab=92.95  E-value=0.035  Score=35.09  Aligned_cols=50  Identities=22%  Similarity=0.258  Sum_probs=34.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHC
Q ss_conf             11111122222222222222223443204887327774367999999842
Q gi|254780916|r  137 CALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHES  186 (482)
Q Consensus       137 ~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~  186 (482)
T Consensus       118 ~tl~dlv~~g~~t~~~~~~L~~aV~~r~nilVsGgTGSGKTTllnaL~~~  167 (323)
T PRK13833        118 IPLDDYVRSKVMTEAQASTIRSAISSRLNIVISGGTGSGKTTLANAVIAE  167 (323)
T ss_pred             CCHHHHHHCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHH
T ss_conf             99999987699999999999999981896899917777568999999986