HHsearch alignment for GI: 254780916 and conserved domain: PTZ00112

>PTZ00112 origin recognition complex 1 protein; Provisional.
Probab=96.74  E-value=0.0021  Score=43.74  Aligned_cols=226  Identities=13%  Similarity=0.139  Sum_probs=129.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC---CCCEEEEEECCCCCHHHHHHH----HHHHCCCCC---CCCCCCCCCCCCCCC---
Q ss_conf             1111222222222222222234---432048873277743679999----998426754---332101234655421---
Q gi|254780916|r  139 LDSLIAVSPAMIQVVDLARKAG---DCAIPIMIQGEFGVGKKRLSR----FIHESGKRA---FFPFFIVNCGMIDQD---  205 (482)
Q Consensus       139 ~~~LiG~S~~m~~v~~~i~~~a---~~~~~vli~Ge~GtGK~~~A~----~iH~~s~r~---~~~fi~v~c~~~~~~---  205 (482)
T Consensus       266 pe~lpcRe~E~~~I~~Fie~~i~q~GtG~cLYISGVPGTGKTATV~eVIr~L~~~~~~~~lp~F~fVEINGMkLt~P~qa  345 (650)
T PTZ00112        266 PEYILGREKEAKEIRTFLETGIKQGGTGQILYISGVPGTGKTATVYMVIKELQNKKLKGQLPWFNLFEINGVNLVHPNAA  345 (650)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCEECCCHHHH
T ss_conf             74477707899999999986411688665699978999980036999999999999708999815999736377987889


Q ss_pred             --CCHHHHHCCCCCCC-CCCCCCCCCCCCCCC-CEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEC
Q ss_conf             --00243311255553-221110012344667-14751664200188999888877642001123553212343156521
Q gi|254780916|r  206 --KIEKFLFGDVDLQT-KNSAQFLGKFIEANG-GTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLT  281 (482)
Q Consensus       206 --~~e~~lFG~~~~~~-~~~~~~~g~~~~a~~-Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t  281 (482)
T Consensus       346 Y~~L~e~Ltg~k~~~~~~A~~lL~k~F~~~r~p~VlLvDELD~LvTkkQ~VlYNLFdWP--------T~~~SkLIVIaIA  417 (650)
T PTZ00112        346 YRVFYKKLFNKKPPNALNSYKELDKLFNNNRTPSILIVDEADYIVTKTQKVLFTLFDWP--------TKKNSKLILIIIS  417 (650)
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHCCCCEEEECCCCC--------CCCCCEEEEEEEE
T ss_conf             99999998489888678999999998268997189997157777636774577736688--------9888707999985


Q ss_pred             -CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC--CCCCCCH
Q ss_conf             -4332111111233379998865433446778774422225566777641011223333211111000122--3389868
Q gi|254780916|r  282 -EKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTK--YPWIDNV  358 (482)
Q Consensus       282 -~~~L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~--y~WPGNv  358 (482)
T Consensus       418 NTMDLPERL~-~R----VsSRLGltRltF~PYt~~--QL~eII~sRL~------~--~~~f~~dAIQl~ARKVAavSGDA  482 (650)
T PTZ00112        418 NTMDLPYKMK-PS----CRSRLAFGRLVFSPYKYQ--QIEKVIKERLE------N--CEIIDHTALQLCARRVTNYSGDM  482 (650)
T ss_pred             ECCCCCHHHH-HH----HHHHCCCCEECCCCCCHH--HHHHHHHHHHC------C--CCCCCHHHHHHHHHHHHHHCCHH
T ss_conf             0678606566-66----555228850043998999--99999999862------6--77788789999988887503148


Q ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHC
Q ss_conf             99999999998743898106889545421
Q gi|254780916|r  359 QELKNILLRAVIGLKDSHLTEDRFVLLLS  387 (482)
Q Consensus       359 REL~n~i~r~~i~~~~~~i~~~~~~~~l~  387 (482)
T Consensus       483 RRALdICRRAvE~~~~~ki~~~~i~~a~n  511 (650)
T PTZ00112        483 RKALQICKLAFENKNGGKITPRDMTRASN  511 (650)
T ss_pred             HHHHHHHHHHHHHCCCCEEEHHHHHHHHH
T ss_conf             99999999999735687342489999988