HHsearch alignment for GI: 254780916 and conserved domain: TIGR02782

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer . TrbB is a homologue of the vir system VirB11 ATPase , and the Flp pilus system ATPase TadA ..
Probab=94.26  E-value=0.018  Score=37.16  Aligned_cols=51  Identities=22%  Similarity=0.268  Sum_probs=36.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             111111112222222222222222344320488732777436799999984
Q gi|254780916|r  135 EHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHE  185 (482)
Q Consensus       135 ~~~~~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~  185 (482)
T Consensus       111 ~vfTLDdYV~~gimtaaQ~d~l~~Av~ar~NIlv~GGTGSGKTTLaNAlla  161 (315)
T TIGR02782       111 RVFTLDDYVEAGIMTAAQRDVLREAVAARKNILVVGGTGSGKTTLANALLA  161 (315)
T ss_pred             CCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHH
T ss_conf             104707776404455789999999997129889981458857999999999