HHsearch alignment for GI: 254780916 and conserved domain: TIGR02915

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT). These proteins have a Fis family DNA binding sequence, a response regulator receiver domain, and sigma-54 interaction domain. They are found strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria, where members of IPR014265 from INTERPRO and IPR014266 from INTERPRO also occur..
Probab=100.00  E-value=0  Score=916.84  Aligned_cols=434  Identities=28%  Similarity=0.388  Sum_probs=397.5

Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEECC--HHHHHHHCCCCCEEEEECCCCCC-----CHHHHHHHHHHHCCCCCEEE
Q ss_conf             899869989999999999988988999893--79999860899899997854698-----88999999998578983999
Q gi|254780916|r   13 VLIIDKDDEQIKIIKDHVESYGYDVFIVNV--SDLSTISKIQVNVIFLSLINCED-----DKENILKNIVDKIPIVPIIV   85 (482)
Q Consensus        13 ILIVDDd~~~~~~l~~~L~~~G~~v~~a~~--~al~~l~~~~~dlillD~~mP~~-----dGlell~~i~~~~p~ipvIi   85 (482)
T Consensus         1 LLiVeDD~glQKQLkWs~G~~-Ye~~~A~DR~sAiA~vRRheP~VVTLDLGLPPd~d~a~EGl~~L~qIL~~~P~TKVIV   79 (451)
T TIGR02915         1 LLIVEDDLGLQKQLKWSFGAD-YEVAVAADRESAIALVRRHEPAVVTLDLGLPPDADGASEGLAALQQILAIAPDTKVIV   79 (451)
T ss_pred             CCEEECCHHHHHHHHHHCCCC-CEEEEECCHHHHHHHHHCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             924536866567876415788-4035534757899986056996477367557898874589999999996389804899


Q ss_pred             EECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCC---CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             926899999998885057432222222222222222222222222222-----211---111111222222222222222
Q gi|254780916|r   86 QTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQE-----NEH---CALDSLIAVSPAMIQVVDLAR  157 (482)
Q Consensus        86 iT~~~~~~~~~~a~~~g~~d~l~KP~~~~~L~~~i~~al~~~~~~~~~-----~~~---~~~~~LiG~S~~m~~v~~~i~  157 (482)
T Consensus        80 iTGN~~r~NAlkAi~lGAYDFyqKP~d~d~L~liv~RAf~L~~Le~ENRrL~~~~~~Gst~~~Gli~~~~~m~kic~tIe  159 (451)
T TIGR02915        80 ITGNDDRENALKAIGLGAYDFYQKPIDPDVLKLIVDRAFRLYTLETENRRLQSALGGGSTALEGLITSSPGMQKICRTIE  159 (451)
T ss_pred             EECCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCCHHHHHHHHH
T ss_conf             86689838899996437510135787578999999998888888887699874068874103652206850678988865


Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCC-CCCCCCCCCCCCCCCCCCCE
Q ss_conf             23443204887327774367999999842675433210123465542100243311255-55322111001234466714
Q gi|254780916|r  158 KAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVD-LQTKNSAQFLGKFIEANGGT  236 (482)
Q Consensus       158 ~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~-~~~~~~~~~~g~~~~a~~Gt  236 (482)
T Consensus       160 kvA~sd~TvllLGESGTGKEV~ArA~H~~S~R~~~~FVAINCAAIPEnLLEsELFGyEKGAFTGA~k~T~GKIE~A~~GT  239 (451)
T TIGR02915       160 KVAPSDITVLLLGESGTGKEVLARALHELSDRKDKRFVAINCAAIPENLLESELFGYEKGAFTGAVKQTLGKIEYAHGGT  239 (451)
T ss_pred             HHCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHCCCCHHHHHHHCCCCCCEEEECCCC
T ss_conf             21200001301046671178999898420578977734441674575246677603410124220034776167506883


Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             75166420018899988887764200112355321234315652143321111112333799988654334467787744
Q gi|254780916|r  237 IVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRS  316 (482)
Q Consensus       237 l~l~ei~~L~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g~fr~dLy~rL~~~~i~iPpLReR~  316 (482)
T Consensus       240 LFLDEIGDLP~~LQAKLLRFLQErVIER~GGR~eIPVDVRvvCATnqdL~~~i~eg~FREDLfYRl~Eisi~iPPLR~R~  319 (451)
T TIGR02915       240 LFLDEIGDLPLNLQAKLLRFLQERVIERLGGREEIPVDVRVVCATNQDLKKMIAEGTFREDLFYRLAEISITIPPLRDRD  319 (451)
T ss_pred             CCCCCHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCCCH
T ss_conf             01111220676689999987546663105887245614267503224689998548972000134666786258899860


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCC
Q ss_conf             22225566777641011223333211111000122338986899999999998743898106889545421244543223
Q gi|254780916|r  317 EDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREF  396 (482)
Q Consensus       317 eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~r~~i~~~~~~i~~~~~~~~l~~~~~~~~~~  396 (482)
T Consensus       320 gDa~lLA~~Fl~rf~~~~k~~~~~F~~DA~~ale~h~WPGNvRELEN~vKRAVIMa~g~qIt~~DLGl~~~Pi~~~----  395 (451)
T TIGR02915       320 GDAVLLANAFLERFARELKRKAKGFTDDALRALEAHKWPGNVRELENKVKRAVIMAEGNQITAEDLGLDAKPIERA----  395 (451)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCHHHHHCHHHEEEEECCCCCCCHHHCCCCCCCCCCC----
T ss_conf             1899999999998878733021660699999976069988415440300213453378713565488886777754----


Q ss_pred             CCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             4322222233444321000000001123444543258999-999999999999828727899978489988999999981
Q gi|254780916|r  397 HTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLS-DIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREY  475 (482)
Q Consensus       397 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-e~E~~~I~~aL~~~~Gn~~~aA~~LGIsR~tL~rKlk~~  475 (482)
T Consensus       396 ---------------~~------------~l~~~~LR~vRe~aEr~av~~A~a~~~GN~arAaElLGitRPTLYdLm~k~  448 (451)
T TIGR02915       396 ---------------ET------------PLEGLNLREVREKAEREAVRKAIARVDGNIARAAELLGITRPTLYDLMKKY  448 (451)
T ss_pred             ---------------CH------------HHCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             ---------------01------------111451889999999999999998726618889887258203599999972


Q ss_pred             CCC
Q ss_conf             888
Q gi|254780916|r  476 NIE  478 (482)
Q Consensus       476 gi~  478 (482)
T Consensus       449 g~~  451 (451)
T TIGR02915       449 GLK  451 (451)
T ss_pred             CCC
T ss_conf             589