HHsearch alignment for GI: 254780916 and conserved domain: cd02024

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=93.21  E-value=0.38  Score=27.70  Aligned_cols=159  Identities=15%  Similarity=0.181  Sum_probs=72.1

Q ss_pred             EEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCHH
Q ss_conf             88732777436799999984267543321012346554210024331125555322111001234466714751664200
Q gi|254780916|r  166 IMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDAL  245 (482)
Q Consensus       166 vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lFG~~~~~~~~~~~~~g~~~~a~~Gtl~l~ei~~L  245 (482)
T Consensus         2 IgIaG~S~SGKTTla~~L~~~l~---------~~~iI~qDdy-----------Yk~~~----~~~~~~~~~~NfDhP~Ai   57 (187)
T cd02024           2 VGISGVTNSGKTTLAKLLQRILP---------NCCVIHQDDF-----------FKPED----EIPVDENGFKQWDVLEAL   57 (187)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCC---------CCEEECCCCC-----------CCCCC----CCCHHHCCCCCCCCCCCC
T ss_conf             89968888759999999999879---------9889715446-----------78843----276213057687670120


Q ss_pred             HHHHHHHHHHHHHHHH-CC-CCCCC----CCCC-------CCCEEEEECC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1889998888776420-01-12355----3212-------3431565214-33211111123337999886543344677
Q gi|254780916|r  246 PLAVQGRIYNFIETGK-IE-FFDSR----GAIR-------LDVRLIFLTE-KNLLPQVKSHVFRKDLYYRISVFLINIST  311 (482)
Q Consensus       246 ~~~~Q~~Ll~~l~~~~-~~-~~g~~----~~~~-------~~~RiIa~t~-~~L~~~~~~g~fr~dLy~rL~~~~i~iPp  311 (482)
T Consensus        58 D~~~l~~~L~~l~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~r~~~~~~~~p~~iiIvEG~l-----------l~~~~~  126 (187)
T cd02024          58 DMEAMMSTLDYWRETGHFPKFLRSHGNENDPEKEFIEDAQIEETKADLLGAEDLHILIVDGFL-----------LYNYKP  126 (187)
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCEEEEEECHH-----------HCCCHH
T ss_conf             589999999999948976431013343566775674102221120001146896499991778-----------719899


Q ss_pred             HHHHHHHHHHHHH-----HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8774422225566-----777641011223333211111000122338986899
Q gi|254780916|r  312 LRSRSEDIPWLVH-----FFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQE  360 (482)
Q Consensus       312 LReR~eDI~~L~~-----~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvRE  360 (482)
T Consensus       127 lr~l~-DlkiFvd~~~d~~l~RR~~Rd~~~~~~g~~~D~~~yf~~~V~P~y~k~  179 (187)
T cd02024         127 LVDLF-DIRYFLRVPYETCKRRREARTGYVTLEGFWPDPPGYFDGHVWPMYLKH  179 (187)
T ss_pred             HHHHC-CEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCHHHHCEECHHHHHH
T ss_conf             99863-967999699999999975257854268478999526525041538988