HHsearch alignment for GI: 254780916 and conserved domain: cd02068

>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain. This domain shows similarity with B12 (adenosylcobamide) binding domains found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase, but it lacks the signature motif Asp-X-His-X-X-Gly, which contains the histidine that acts as a cobalt ligand. The function of this domain remains unclear.
Probab=93.41  E-value=0.65  Score=26.08  Aligned_cols=88  Identities=15%  Similarity=0.114  Sum_probs=58.8

Q ss_pred             HHHHHHHHHHHHCCCEEEEECC----HHH-HHHHCCCCCEEEEECCCCCCC-HHHHHHHHHHHCCCCCEEEEECCCCHHH
Q ss_conf             9999999999988988999893----799-998608998999978546988-8999999998578983999926899999
Q gi|254780916|r   21 EQIKIIKDHVESYGYDVFIVNV----SDL-STISKIQVNVIFLSLINCEDD-KENILKNIVDKIPIVPIIVQTTQDNIKI   94 (482)
Q Consensus        21 ~~~~~l~~~L~~~G~~v~~a~~----~al-~~l~~~~~dlillD~~mP~~d-Glell~~i~~~~p~ipvIiiT~~~~~~~   94 (482)
T Consensus         3 LGl~ylaa~L~~~G~~v~~~d~~~~~~~~e~~~~~~~pdvvg~s~~~~~~~~~~~~~~~~k~~~p~~~iv~GG~h~t~~p   82 (127)
T cd02068           3 LGLAYLAAVLEDAGFIVAEHDVLSADDIVEDIKELLKPDVVGISLMTSAIYEALELAKIAKEVLPNVIVVVGGPHATFFP   82 (127)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             79999999999789957998578762039999864996999999768899999999999999789978998598745499


Q ss_pred             HHHHHHCCCCCCCCC
Q ss_conf             998885057432222
Q gi|254780916|r   95 LNCFLYNRISKFFLN  109 (482)
Q Consensus        95 ~~~a~~~g~~d~l~K  109 (482)
T Consensus        83 -~~~l~~~~~D~vv~   96 (127)
T cd02068          83 -EEILEEPGVDFVVI   96 (127)
T ss_pred             -HHHHHCCCCCEEEE
T ss_conf             -99970758778996