>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=91.08 E-value=1.3 Score=24.02 Aligned_cols=119 Identities=13% Similarity=0.201 Sum_probs=56.2 Q ss_pred EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHH---CCCCCCCCCCCCCCCCCCCCCCCEEEECC Q ss_conf 488732777436799999984267543321012346554210024331---12555532211100123446671475166 Q gi|254780916|r 165 PIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLF---GDVDLQTKNSAQFLGKFIEANGGTIVLEE 241 (482) Q Consensus 165 ~vli~Ge~GtGK~~~A~~iH~~s~r~~~~fi~v~c~~~~~~~~e~~lF---G~~~~~~~~~~~~~g~~~~a~~Gtl~l~e 241 (482) T Consensus 2 KililG~~~sGKTsll~~l~~~~~~~~~pT~g~~~~~~~~~~~~l~iwD~~G~~~~----r~l~~~Y~~~a~~iI~VvD~ 77 (159) T cd04150 2 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI----RPLWRHYFQNTQGLIFVVDS 77 (159) T ss_pred EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCCC----CHHHHHHCCCCCEEEEEEEC T ss_conf 99999999999899999997299677589687017999989899999978997214----65678647687389999977 Q ss_pred CCHHHH-HHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHH Q ss_conf 420018-8999888877642001123553212343156521433211111123337 Q gi|254780916|r 242 PDALPL-AVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRK 296 (482) Q Consensus 242 i~~L~~-~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~~~L~~~~~~g~fr~ 296 (482) T Consensus 78 sd~~~~~~~~~~l~~~l~~~~~------~~~p---ili~~NK~Dl~~~~~~~ei~~ 124 (159) T cd04150 78 NDRERIGEAREELQRMLNEDEL------RDAV---LLVFANKQDLPNAMSAAEVTD 124 (159) T ss_pred CCHHHHHHHHHHHHHHHCCHHH------CCCE---EEEEEECCCCCCCCCHHHHHH T ss_conf 7778999999999999623533------6982---999997566778989999999

HHsearch alignment for GI: 254780916 and conserved domain: cd04150