HHsearch alignment for GI: 254780916 and conserved domain: pfam01078

>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Probab=99.09  E-value=1.4e-10  Score=94.32  Aligned_cols=142  Identities=15%  Similarity=0.115  Sum_probs=90.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCC-CCCCCC----CCCCCCC--CCCHHHH
Q ss_conf             11112222222222222222344320488732777436799999984267543-321012----3465542--1002433
Q gi|254780916|r  139 LDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAF-FPFFIV----NCGMIDQ--DKIEKFL  211 (482)
Q Consensus       139 ~~~LiG~S~~m~~v~~~i~~~a~~~~~vli~Ge~GtGK~~~A~~iH~~s~r~~-~~fi~v----~c~~~~~--~~~e~~l  211 (482)
T Consensus         2 f~di~GQ~~ak----rAl~iAaaG~H~lLl~GpPG~GKTmlA~rl~~iLP~l~~~e~le~~~i~S~~g~~~~~~l~~~rP   77 (207)
T pfam01078         2 LADVKGQEQAK----RALEIAAAGGHNLLMIGPPGSGKTMLAKRLPGILPPLTEQEALEVTAIHSVAGLGGDGGLIRRRP   77 (207)
T ss_pred             HHHHCCCHHHH----HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             76863859999----99999854787589788998029999976301489987899887776423036877777445798


Q ss_pred             HC--C----CCCCC-CCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHC--CCCCCCCCCCCCCEEEEECC
Q ss_conf             11--2----55553-2211100123446671475166420018899988887764200--11235532123431565214
Q gi|254780916|r  212 FG--D----VDLQT-KNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKI--EFFDSRGAIRLDVRLIFLTE  282 (482)
Q Consensus       212 FG--~----~~~~~-~~~~~~~g~~~~a~~Gtl~l~ei~~L~~~~Q~~Ll~~l~~~~~--~~~g~~~~~~~~~RiIa~t~  282 (482)
T Consensus        78 fr~PHhs~s~~aliGGg~~~~PGeIslAH~GVLFLDE~~Ef~~~vle~LrqpLE~~~v~IsRa~~~~~~PA~f~LvaA~N  157 (207)
T pfam01078        78 FRAPHHSASAAALVGGGSIPRPGEISLAHNGVLFLDELPEFSRRVLESLRQPLEDGEITISRARAKVTFPARFQLVAAMN  157 (207)
T ss_pred             CCCCCCCCCHHHCCCCCCCCCCCCEEECCCCEEEECCHHHCCHHHHHHHHHHHCCCCEEEEECCCEEEECCCEEEEEECC
T ss_conf             65788764363322688889997066636878884764653988999998766049489995675898604348888505


Q ss_pred             CC
Q ss_conf             33
Q gi|254780916|r  283 KN  284 (482)
Q Consensus       283 ~~  284 (482)
T Consensus       158 PC  159 (207)
T pfam01078       158 PC  159 (207)
T ss_pred             CC
T ss_conf             77