HHsearch alignment for GI: 254780916 and conserved domain: pfam03215

>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=94.40  E-value=0.35  Score=28.01  Aligned_cols=119  Identities=12%  Similarity=0.056  Sum_probs=57.5

Q ss_pred             EEEECCCCHH----HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECC-------CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             4751664200----1889998888776420011235532123431565214-------3321111112333799988654
Q gi|254780916|r  236 TIVLEEPDAL----PLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTE-------KNLLPQVKSHVFRKDLYYRISV  304 (482)
Q Consensus       236 tl~l~ei~~L----~~~~Q~~Ll~~l~~~~~~~~g~~~~~~~~~RiIa~t~-------~~L~~~~~~g~fr~dLy~rL~~  304 (482)
T Consensus       131 iILIEE~Pn~~~~d~~~fr~~L~~~L~s~~------~~PlV---~IiSEt~s~~g~~~~~~~~~ta~rLlg~eIl~hp~i  201 (490)
T pfam03215       131 LILVEELPNQFYSDAEKFREVIREVLQSIW------HLPLI---FCLTECNSLEGDNNQDRFGIDAETIMTKDILIMPRI  201 (490)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCC------CCCEE---EEEEECCCCCCCCCCCCCCCHHHHHCCHHHHHCCCC
T ss_conf             999965887442366999999999997089------99879---999704666677643323210786359888708896


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             334467787744222255667776410112233332111110001223389868999999999987
Q gi|254780916|r  305 FLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVI  370 (482)
Q Consensus       305 ~~i~iPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~ls~~a~~~L~~y~WPGNvREL~n~i~r~~i  370 (482)
T Consensus       202 ~~I~FNpIA------pT~M~KaL~~I~~kE~~~~~~~~~~~le~Ia~~-S~GDIRsAInsLQF~~~  260 (490)
T pfam03215       202 DTITFNPIA------PTFMKKALVRISVQEGKLKSPKSDSKLEVICQE-AGGDLRSAINSLQFSSS  260 (490)
T ss_pred             CEEEECCCC------HHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHH-CCCCHHHHHHHHHHHCC
T ss_conf             369868887------889999999999985765567520389999986-48729999999998626