RPSBLAST alignment for GI: 254780916 and conserved domain: PRK11361

>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional. Length = 457
 Score =  157 bits (398), Expect = 7e-39
 Identities = 130/490 (26%), Positives = 218/490 (44%), Gaps = 61/490 (12%)

Query: 12  RVLIIDKDDEQIKIIKDHVESYGYDVFIVN--VSDLSTISKIQVNVIFLSLINCEDDKEN 69
           R+LI+D +D   +++       G++    N   + L   + I  +V+ + +   E D   
Sbjct: 6   RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIK 65

Query: 70  ILKNIVDKIPIVPIIVQTT----QDNIKILNCFLYNRISKFF----LNLVSRKQL----C 117
            LK +       P+I+ T     +  ++ L C  ++ + K F    LNL+ ++ L     
Sbjct: 66  ALKEMRSHETRTPVILMTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQSM 125

Query: 118 DSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKK 177
              I  L + +  S +  H     ++  SPAM+ +     K       ++I GE G GK+
Sbjct: 126 KKEIRHLHQALSTSWQWGH-----ILTNSPAMMDICKDTAKIALSQASVLISGESGTGKE 180

Query: 178 RLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFG-DVDLQTKNSAQFLGKFIEANGGT 236
            ++R IH + +RA  PF  VNC  + +  +E  LFG +    T       G F  AN GT
Sbjct: 181 LIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGT 240

Query: 237 IVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRK 296
           ++L+E   +PL +Q ++   ++  + E       I++D+R+I  T ++L   VK   FR+
Sbjct: 241 LLLDEIGEMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFRE 300

Query: 297 DLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWID 356
           DL+YR++V  + +  LR R EDI  L + FLQ F ++N    I I   A+SLLT + W  
Sbjct: 301 DLFYRLNVIHLILPPLRDRREDISLLANHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPG 360

Query: 357 NVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILD 416
           N++EL N++ RAV+                             +    +     S+ +  
Sbjct: 361 NIRELSNVIERAVV---------------------------MNSGPIIF-----SEDLPP 388

Query: 417 NLSQESIPAIG----QDGEVRRL----SDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTL 468
            + Q    A        GE R L      +EK II   ++      +  A  LGI R  L
Sbjct: 389 QIRQPVCNAGEVKTAPVGE-RNLKEEIKRVEKRIIMEVLEQQEGNRTRTALMLGISRRAL 447

Query: 469 YRKIREYNIE 478
             K++EY I+
Sbjct: 448 MYKLQEYGID 457