RPSBLAST alignment for GI: 254780917 and conserved domain: TIGR01842

>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 544
 Score =  198 bits (505), Expect = 4e-51
 Identities = 93/247 (37%), Positives = 144/247 (58%), Gaps = 5/247 (2%)

Query: 336 MIEESP---HAVNLPVGKGTTVFRDVFFSYKQG-HPVLSGINLCFKSGKMTALVGPSGSG 391
           ++   P    A+ LP  +G     +V      G  P L GI+   ++G+  A++GPSGSG
Sbjct: 297 LLANYPSRDPAMPLPEPEGHLSVENVTIVPPGGKKPTLRGISFRLQAGEALAIIGPSGSG 356

Query: 392 KSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGR 451
           KST+  L++ ++ P+SGS+ +DG +++     +  + I Y+ QDV LF  TV  NI    
Sbjct: 357 KSTLARLIVGIWPPTSGSVRLDGADLKQWDRETFGKHIGYLPQDVELFPGTVAENIARFG 416

Query: 452 PMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHIL 511
             A  E++IE AK A  H+ I+ LP GYDT +G  G+ LSGGQ+QRIA+ARA+  D  ++
Sbjct: 417 ENADPEKIIEAAKLAGVHELILRLPDGYDTVIGPGGATLSGGQRQRIALARALYGDPKLV 476

Query: 512 VLDEATSALDTHTENLVRQALSRL-MQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGD 570
           VLDE  S LD   E  +  A+  L  +G T +VI HR S +   D I+ ++DG+++  G+
Sbjct: 477 VLDEPNSNLDEEGEQALANAIKALKARGITVVVITHRPSLLGCVDKILVLQDGRIARFGE 536

Query: 571 QKYLLQQ 577
           +  +L +
Sbjct: 537 RDEVLAK 543