>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5.1.3.13 from EC) is involved in the biosynthesis of dTDP-l-rhamnose, which is an essential component of the bacterial cell wall, converting dTDP-4-keto-6-deoxy-D-glucose to dTDP-4-keto-L-rhamnose. The crystal structure of RmlC from Methanobacterium thermoautotrophicum was determined in the presence and absence of a substrate analogue. RmlC is a homodimer comprising a central jelly roll motif, which extends in two directions into longer beta-sheets. Binding of dTDP is stabilized by ionic interactions to the phosphate group and by a combination of ionic and hydrophobic interactions with the base. The active site, which is located in the centre of the jelly roll, is formed by residues that are conserved in all known RmlC sequence homologues. The active site is lined with a number of charged residues and a number of residues with hydrogen-bonding potentials, which together comprise a potential network for substrate binding and catalysis. The active site is also lined with aromatic residues which provide favorable environments for the base moiety of dTDP and potentially for the sugar moiety of the substrate .; GO: 0008830 dTDP-4-dehydrorhamnose 35-epimerase activity, 0009103 lipopolysaccharide biosynthetic process.

Probab=100.00 E-value=0 Score=506.50 Aligned_cols=174 Identities=49% Similarity=0.870 Sum_probs=169.0 Q ss_pred CCCCCEEEEECCEEEECCCEEEEEECHHHHHH-CCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHH Q ss_conf 96575399707622037950421108898986-79987413442331252000000015555544012100002222234 Q gi|254780919|r 1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDI 79 (198) Q Consensus 1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~-~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dv 79 (198) T Consensus 6 t~IpDv~liEP~VF~D~RGFF~E~yn~~~F~~~~G~~~~FVQdN~S~S-~~GVLRGLHyQ~~~~~QGKLVRv~~GevfDV 84 (181) T TIGR01221 6 TEIPDVLLIEPRVFGDERGFFFETYNQEAFQEAVGIPVRFVQDNHSKS-KKGVLRGLHYQREEHAQGKLVRVLRGEVFDV 84 (181) T ss_pred CCCCCEEEECCEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCC-CCCCCCCEECCCCCCCCCCEEEEEEEEEEEE T ss_conf 347875885455637888613566424678874288763067552265-6784011010188888872678985458877 Q ss_pred HHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCC Q ss_conf 33406421333100113662365302333023220345307453389721787671017021688801177478887676 Q gi|254780919|r 80 AVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL 159 (198) Q Consensus 80 vvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~ 159 (198) T Consensus 85 AVDlRrnSP~fGkWVGv~Ls~~NKrqLWIP~GFAHGF~VLSd~Aev~YK~Td~Y~Pe~e~gi~WNDP~igIdWPl~~~D- 163 (181) T TIGR01221 85 AVDLRRNSPTFGKWVGVLLSAENKRQLWIPEGFAHGFVVLSDEAEVLYKCTDYYAPEYERGIIWNDPDIGIDWPLEDAD- 163 (181) T ss_pred EEECCCCCCCCCEEEEEEECHHCCEECCCCCCCCCCEEEECCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC- T ss_conf 7886786876466999986614281312589744330440416788600104026865773556773331258865578- Q ss_pred C-EECHHHHCCCCHHHCC Q ss_conf 3-0167884599877818 Q gi|254780919|r 160 P-SVSEKDQNLPFLNQID 176 (198) Q Consensus 160 p-iiS~kD~~~p~l~d~~ 176 (198) T Consensus 164 ~~lLS~KD~~~~~l~E~~ 181 (181) T TIGR01221 164 PVLLSEKDRKGPPLAEAE 181 (181) T ss_pred CEEECHHHHCCCCHHHCC T ss_conf 436334350487356369

HHsearch alignment for GI: 254780919 and conserved domain: TIGR01221