HHsearch alignment of GI: 254780919 and MMDB domain: 1j58_A_55-232

>1j58_A (A:55-232) YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal binding protein; 1.75A {Bacillus subtilis}
Probab=95.29  E-value=0.022  Score=33.88  Aligned_cols=108  Identities=22%  Similarity=0.243  Sum_probs=69.2

Q ss_pred             EEEECCCEEEEEECHHHHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHH
Q ss_conf             22037950421108898986799874134423312520000000155555440121000022222343340642133310
Q gi|254780919|r   13 KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGC   92 (198)
Q Consensus        13 ~f~D~RG~f~e~f~~~~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk   92 (198)
                      .|.-+-|.+.+.-. ..+..+ .......  ..  -.+|.++-.|++..    +-.++++.|.....+++-      -++
T Consensus         3 ~~~~~~G~~~~~~~-~~~p~l-~~~~~~~--~~--l~pg~~~~pH~h~~----~e~~~vv~g~~~~~~~~~------~~~   66 (178)
T 1j58_A            3 NRLEKGGYAREVTV-RELPIS-ENLASVN--XR--LKPGAIRELHWHKE----AEWAYXIYGSARVTIVDE------KGR   66 (178)
T ss_dssp             CEEETTEEEEEECT-TTCTTC-SSCEEEE--EE--ECTTCEEEEEEESS----CEEEEEEEEEEEEEEECT------TSC
T ss_pred             CCCCCCCCEEEEEH-HHCCCH-HHHHHEE--EE--ECCCCCCCCCCCCC----CCEEEEEECEEEEEEEEC------CCC
T ss_conf             52157971278656-668241-1110137--89--76996748616363----037999958799999908------994


Q ss_pred             EEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHC
Q ss_conf             0113662365302333023220345307453389721787671017
Q gi|254780919|r   93 WVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHD  138 (198)
Q Consensus        93 ~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e  138 (198)
                      .....|.+  +..++||+|+.|......+...++....+.-++..+
T Consensus        67 ~~~~~l~~--Gdv~~iP~g~~h~~~n~~~~~~~~~~~~~~~~~~~~  110 (178)
T 1j58_A           67 SFIDDVGE--GDLWYFPSGLPHSIQALEEGAEFLLVFDDGSFSENS  110 (178)
T ss_dssp             EEEEEEET--TEEEEECTTCCEEEEEEEEEEEEEEEESCTTCCGGG
T ss_pred             EEEEEECC--CCEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCC
T ss_conf             89988536--878998999769997269996899997688866554