HHsearch alignment of GI: 254780919 and MMDB domain: 1wlt_A_

>1wlt_A (A:) 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii}
Probab=100.00  E-value=0  Score=339.86  Aligned_cols=166  Identities=34%  Similarity=0.587  Sum_probs=160.6

Q ss_pred             CCCCEEEEECCEEEECCCEEEEEECHHHHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHH
Q ss_conf             65753997076220379504211088989867998741344233125200000001555554401210000222223433
Q gi|254780919|r    2 NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAV   81 (198)
Q Consensus         2 ~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvv   81 (198)
                      .|+||++++++.|.|+||+|.|+|+.+++.+++ .+.|+|+|+|.| ++||+||+|+|..+++|+|+++|++|+|++|+|
T Consensus        28 ~i~gv~ii~~~~~~D~RG~l~e~~~~~~~~~~~-~~~~~qv~~s~s-~~GviRG~H~h~~~~~q~k~~~v~~G~v~~vlv  105 (196)
T 1wlt_A           28 LGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMR-IPNVIQTNMSFS-RKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAV  105 (196)
T ss_dssp             EETTEEEEEECCEEETTEEEEEEEEHHHHHHTT-CCCEEEEEEEEE-CTTBEEEEEEECTTSCCEEEEEEEESEEEEEEE
T ss_pred             CCCEEEEEECCCEECCCCCEEEEECHHHHHHCC-CCCEEEEEEEEC-CHHEEEEEEECCCCCCCEEEEEEECCCEEEEEE
T ss_conf             875799998982276985288982345898728-985599774350-301688745422357750799982583699997


Q ss_pred             HCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCCCE
Q ss_conf             40642133310011366236530233302322034530745338972178767101702168880117747888767630
Q gi|254780919|r   82 DIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS  161 (198)
Q Consensus        82 DlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~pi  161 (198)
                      |+|++|||||++..++|+++++++|+||+||||||++++++++++|+++..|+|+.+.+++|+||.++|+||       |
T Consensus       106 D~R~~SPT~g~~~~~~l~~~~~~~l~IPpGv~Hg~~~l~~~~~l~~~~~~~y~p~~~~~i~~~dp~~~i~Wp-------i  178 (196)
T 1wlt_A          106 DVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEV-------I  178 (196)
T ss_dssp             ECBTTSTTTTCEEEEEEETTTCCEEEECTTEEEEEEESSSEEEEEEEESSCCCGGGEEECCGGGSCCSCSSC-------B
T ss_pred             EECCCCCCCCEEEEEEECCCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCCCHHCCEECCCCCCCCCCCC-------E
T ss_conf             613689951013455321453446997531636776326320589862851281013556358827999988-------9


Q ss_pred             ECHHHHCCCCHHHCC
Q ss_conf             167884599877818
Q gi|254780919|r  162 VSEKDQNLPFLNQID  176 (198)
Q Consensus       162 iS~kD~~~p~l~d~~  176 (198)
                      |||||+++|.|+|++
T Consensus       179 ~s~~D~~~~~l~~~~  193 (196)
T 1wlt_A          179 ISDKDLQCPSLEKAE  193 (196)
T ss_dssp             CCHHHHTCCCTTTSC
T ss_pred             ECHHHCCCCCHHHCC
T ss_conf             998791999935514