HHsearch alignment of GI: 254780919 and MMDB domain: 2fqp_A_

>2fqp_A (A:) Hypothetical protein BP2299; NP_880937.1, structural genomics, joint center for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I}
Probab=91.28  E-value=0.36  Score=26.86  Aligned_cols=71  Identities=15%  Similarity=0.149  Sum_probs=47.5

Q ss_pred             EEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEEC
Q ss_conf             44233125200000001555554401210000222223433406421333100113662365302333023220345307
Q gi|254780919|r   41 QDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE  120 (198)
Q Consensus        41 Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~  120 (198)
                      +.....- .+|.-.++|++..   ..-+++|++|+....+-+         .-..+.|.+  +..++||+|..|++...+
T Consensus        19 ~~~~~~~-~pg~~~~~H~H~~---~~e~~~vl~G~~~~~~~~---------~~~~~~l~~--Gd~~~ip~~~~H~~~N~~   83 (97)
T 2fqp_A           19 KVTEWRF-PPGGETGWHRHSX---DYVVVPXTTGPLLLETPE---------GSVTSQLTR--GVSYTRPEGVEHNVINPS   83 (97)
T ss_dssp             EEEEEEE-CTTCBCCSEECCS---CEEEEESSCEEEEEEETT---------EEEEEEECT--TCCEEECTTCEEEEECCS
T ss_pred             EEEEEEE-CCCCCCCCEECCC---CEEEEEEECCEEEEEECC---------CCEEEEECC--CEEEEEECCEEEEEEECC
T ss_conf             9999998-5777736312268---749999989899999876---------515888536--529999578089999899


Q ss_pred             CCCEEE
Q ss_conf             453389
Q gi|254780919|r  121 MNTEVI  126 (198)
Q Consensus       121 d~~~i~  126 (198)
                      +.....
T Consensus        84 ~~~~~~   89 (97)
T 2fqp_A           84 DTEFVF   89 (97)
T ss_dssp             SSCEEE
T ss_pred             CCEEEE
T ss_conf             955999