HHsearch alignment of GI: 254780919 and MMDB domain: 2o1q_A_

>2o1q_A (A:) Putative acetyl/propionyl-COA carboxylase, alpha subunit; ZP_00243239.1, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum PM1}
Probab=90.47  E-value=0.13  Score=29.35  Aligned_cols=63  Identities=11%  Similarity=-0.102  Sum_probs=48.5

Q ss_pred             ECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEE
Q ss_conf             12520000000155555440121000022222343340642133310011366236530233302322034530745338
Q gi|254780919|r   46 FSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV  125 (198)
Q Consensus        46 ~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i  125 (198)
                      +...+|.....|.+..    .-.++|++|++.+-..+++++                 ..+++|+|.-|++.+.++.+..
T Consensus        49 ~~~~pG~~~p~H~H~~----~e~~~Vl~G~~~~~~~~~~~G-----------------d~~~~p~g~~H~~~~~~~~~~~  107 (145)
T 2o1q_A           49 FDCPAGSSFAAHVHVG----PGEYFLTKGKXDVRGGKAAGG-----------------DTAIAPGYGYESANARHDKTEF  107 (145)
T ss_dssp             EEECTTEEECCEEESS----CEEEEEEEEEEEETTCGGGTS-----------------EEEESSEEEEECTTCEESCCEE
T ss_pred             EEECCCCCCCCCCCCC----CEEEEEEEEEEEECCCCCCCC-----------------CEEECCCEEEECCCCEECCEEC
T ss_conf             9967874838985413----789999942798177874798-----------------2787893778379986742458


Q ss_pred             EEEE
Q ss_conf             9721
Q gi|254780919|r  126 IYKV  129 (198)
Q Consensus       126 ~Y~~  129 (198)
                      ...|
T Consensus       108 ~~~~  111 (145)
T 2o1q_A          108 PVAS  111 (145)
T ss_dssp             EEEE
T ss_pred             CCCE
T ss_conf             9987