HHsearch alignment of GI: 254780919 and MMDB domain: 2phl_A_20-214

>2phl_A (A:20-214) Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris}
Probab=93.52  E-value=0.032  Score=32.91  Aligned_cols=104  Identities=13%  Similarity=0.049  Sum_probs=62.2

Q ss_pred             CEEEECCCEEEEE--ECHH--HHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCH
Q ss_conf             6220379504211--0889--89867998741344233125200000001555554401210000222223433406421
Q gi|254780919|r   12 RKFEDSRGWFSQT--YSSK--LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNS   87 (198)
Q Consensus        12 ~~f~D~RG~f~e~--f~~~--~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~S   87 (198)
                      +++.-+-|.+..+  +...  .+... -...+  ....+  .+|.++-.|++..    ..+++|++|+...-+++-... 
T Consensus         5 ~~~~~~~G~~~~~~~~~~~~~~~~~~-~~~~~--~~~~l--~pg~~~~phh~~a----~e~~yV~~G~~~v~~~~~~~~-   74 (195)
T 2phl_A            5 TLFKNQYGHIRVLQRFDQQSKRLQNL-EDYRL--VEFRS--KPETLLLPQQADA----ELLLVVRSGSAILVLVKPDDR-   74 (195)
T ss_dssp             EEEEETTEEEEEECCHHHHCGGGGGG-TTCEE--EEEEE--CSSEEEEEEEESE----EEEEEEEESEEEEEEEETTTE-
T ss_pred             CCEECCCCEEEEECCCCCCCHHHCCC-CCEEE--EEEEE--CCCCEECCCCCCC----CEEEEEEECEEEEEEEECCCC-
T ss_conf             63574894299750556428445365-31489--99996--7980788654799----859999938799999948995-


Q ss_pred             HHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEE
Q ss_conf             3331001136623653023330232203453074533897
Q gi|254780919|r   88 PTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY  127 (198)
Q Consensus        88 pTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y  127 (198)
                      .++.+..+..|.  .+..++||+|.+|.+....++..+..
T Consensus        75 ~~~~~~~~~~l~--~Gdv~~iP~G~~H~~~N~~~~~~~~~  112 (195)
T 2phl_A           75 REYFFLTSDNPI--FSDHQKIPAGTIFYLVNPDPKEDLRI  112 (195)
T ss_dssp             EEEEEEESSCTT--SCSEEEECTTCEEEEEECCSSCCEEE
T ss_pred             CEEEEEHHCCCC--CCCEEEECCCCEEEEEECCCCCEEEE
T ss_conf             345321004655--48879988998699995799935999