HHsearch alignment of GI: 254780919 and MMDB domain: 3c3v_A_1-343

>3c3v_A (A:1-343) Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}
Probab=92.15  E-value=0.39  Score=26.68  Aligned_cols=107  Identities=17%  Similarity=0.131  Sum_probs=66.5

Q ss_pred             EECCEEEECCCEEEEEECHH--HHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCC
Q ss_conf             70762203795042110889--8986799874134423312520000000155555440121000022222343340642
Q gi|254780919|r    9 LKTRKFEDSRGWFSQTYSSK--LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRN   86 (198)
Q Consensus         9 i~~~~f~D~RG~f~e~f~~~--~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~   86 (198)
                      .+|..--..-|.++|+|..+  .|.-+|.....    ..+  ++|-|..-||...|    |+++|+.|+-..-+|-.- -
T Consensus        20 ~eP~~~~~segg~~E~~~~~~~qlqcagV~v~r----~~I--~~~gl~lP~y~~a~----~i~yV~qG~G~~giv~Pg-c   88 (343)
T 3c3v_A           20 QRPDNRIESEGGYIETWNPNNQEFECAGVALSR----LVL--RRNALRRPFYSNAP----QEIFIQQGRGYFGLIFPG-C   88 (343)
T ss_dssp             BCCCEEEEETTEEEEECCTTSHHHHHHTCEEEE----EEE--CTTEEEEEEECSSC----EEEEEEECCEEEEEECTT-C
T ss_pred             CCCCCCEECCCCEEEECCCCCCHHHCCCCEEEE----EEE--CCCCEECCCCCCCC----EEEEEEECEEEEEEECCC-C
T ss_conf             897320024786567359998222016713568----887--57845066536897----589998474899998379-8


Q ss_pred             HHHHH----------------------------HE--EEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEE
Q ss_conf             13331----------------------------00--11366236530233302322034530745338972
Q gi|254780919|r   87 SPTYG----------------------------CW--VSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK  128 (198)
Q Consensus        87 SpTfg----------------------------k~--~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~  128 (198)
                      +.||-                            ..  ....|  ..+..+-||+|++|-.+.-.+...+.-.
T Consensus        89 ~et~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~hqkv~rl--r~GDV~aiPAG~~~w~yn~gn~~Lv~v~  158 (343)
T 3c3v_A           89 PSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF--NEGDLIAVPTGVAFWLYNDHDTDVVAVS  158 (343)
T ss_dssp             CCCEEEECCC--------------------CEEEEESCCEEE--CTTEEEEECTTCEEEEEECSSSCEEEEE
T ss_pred             CCHHHCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC--CCCCEEEECCCCEEEEEECCCCCEEEEE
T ss_conf             003206023034332334322333222100000110036842--6798899789854999858998679999