HHsearch alignment of GI: 254780919 and MMDB domain: 3eqe_A_

>3eqe_A (A:) Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis}
Probab=92.85  E-value=0.12  Score=29.69  Aligned_cols=79  Identities=9%  Similarity=0.057  Sum_probs=55.5

Q ss_pred             CCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEE
Q ss_conf             52000000015555544012100002222234334064213331001136623653023330232203453074533897
Q gi|254780919|r   48 FDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY  127 (198)
Q Consensus        48 ~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y  127 (198)
                      ..+|.-.++|.+...   .-++.|++|++...+.|...+..+.+  ..+.|.+  +.+++||+|..|.+...++...+..
T Consensus        76 ~~PG~~~~~H~H~~~---~e~~~vl~G~~~~~~~~~~~~~~~~~--~~~~l~~--Gd~~~ip~g~~H~~~N~g~~~~~~l  148 (171)
T 3eqe_A           76 IPPNKETTVHDHGQS---IGCAXVLEGKLLNSIYRSTGEHAELS--NSYFVHE--GECLISTKGLIHKXSNPTSERXVSL  148 (171)
T ss_dssp             ECTTCBCCEECCTTC---EEEEEEEESEEEEEEEEECSSSEEEE--EEEEEET--TCEEEECTTCEEEEECCSSSCEEEE
T ss_pred             ECCCCCCCCEECCCC---CEEEEEECCEEEEEEEEECCCCCCCC--CEEECCC--CCEEECCCCCEEEEECCCCCCEEEE
T ss_conf             899996676218998---18999823658999865136665555--1354158--8278628998688885999988999


Q ss_pred             -EECCCC
Q ss_conf             -217876
Q gi|254780919|r  128 -KVTDFY  133 (198)
Q Consensus       128 -~~~~~y  133 (198)
                       ..+..|
T Consensus       149 ~v~spp~  155 (171)
T 3eqe_A          149 HVYSPPL  155 (171)
T ss_dssp             EEEESCC
T ss_pred             EEECCCC
T ss_conf             9989997