HHsearch alignment of GI: 254780919 and MMDB domain: 3ht1_A_

>3ht1_A (A:) REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A
Probab=93.20  E-value=0.12  Score=29.53  Aligned_cols=67  Identities=22%  Similarity=0.228  Sum_probs=46.4

Q ss_pred             CCCCEEEECCCCCCCCCHHHHEEECHHHHHHHH-HHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEE
Q ss_conf             520000000155555440121000022222343-3406421333100113662365302333023220345307453389
Q gi|254780919|r   48 FDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIA-VDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI  126 (198)
Q Consensus        48 ~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvv-vDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~  126 (198)
                      ..+|...++|.+..    .-+++|++|+....+ .+-          ..+.|.+  +.++++|+|..|+|...++.....
T Consensus        46 ~~pG~~~~~H~H~~----~e~~~vl~G~~~~~~~~~~----------~~~~l~~--Gd~i~~p~~~~H~~~n~~~~~~~~  109 (145)
T 3ht1_A           46 VSPNGSTPPHFHEW----EHEIYVLEGSMGLVLPDQG----------RTEEVGP--GEAIFIPRGEPHGFVTGPGQTCRF  109 (145)
T ss_dssp             EEEEEECCCEECSS----CEEEEEEEECEEEEEGGGT----------EEEEECT--TCEEEECTTCCBEEECCTTCCEEE
T ss_pred             ECCCCCCCCCCCCC----CEEEEEEEEEEEEEECCCC----------CCEEECC--CEEEECCCCCEEEEEECCCCCEEE
T ss_conf             87654567310256----2199999976445512344----------3179436--547877999839989899999999


Q ss_pred             EEEC
Q ss_conf             7217
Q gi|254780919|r  127 YKVT  130 (198)
Q Consensus       127 Y~~~  130 (198)
                      ..+.
T Consensus       110 l~i~  113 (145)
T 3ht1_A          110 LVVA  113 (145)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9998