HHsearch results for GI: 254780919 and protein with PDBid: 1o4t_A

>1o4t_A Putative oxalate decarboxylase; TM1287, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.95A {Thermotoga maritima} SCOP: b.82.1.9
Probab=91.44  E-value=0.18  Score=27.72  Aligned_cols=63  Identities=17%  Similarity=0.183  Sum_probs=44.8

Q ss_pred             CCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEE
Q ss_conf             5200000001555554401210000222223433406421333100113662365302333023220345307453389
Q gi|254780919|r   48 FDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI  126 (198)
Q Consensus        48 ~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~  126 (198)
                      ..+|.-.++|++..   +..+++|++|+....+ |        ++  .+.+.+  +..++||+|..|++...++.....
T Consensus        64 l~PG~~~~~H~H~~---~~E~~~vl~G~~~~~~-~--------~~--~~~l~~--Gd~i~ip~g~~H~~~N~g~~~l~~  126 (133)
T 1o4t_A           64 LPPGSSVGLHKHEG---EFEIYYILLGEGVFHD-N--------GK--DVPIKA--GDVCFTDSGESHSIENTGNTDLEF  126 (133)
T ss_dssp             ECTTCEEEEEECCS---EEEEEEEEESEEEEEE-T--------TE--EEEEET--TEEEEECTTCEEEEECCSSSCEEE
T ss_pred             ECCCCCCCCEECCC---CEEEEEEECCCEEEEE-C--------CE--EEEECC--CEEEEECCCCEEEEEECCCCCEEE
T ss_conf             99998668788899---7499999478289998-8--------70--599128--849998998969989999999999