HHsearch results for GI: 254780919 and protein with PDBid: 1oi6_A

>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A
Probab=100.00  E-value=0  Score=400.66  Aligned_cols=178  Identities=28%  Similarity=0.472  Sum_probs=167.8

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC--CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHH
Q ss_conf             965753997076220379504211088989867--998741344233125200000001555554401210000222223
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFD   78 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~--~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~d   78 (198)
                      ++|+||++++++.|+|+||+|.|+|+.+++.+.  +..+.++|+|+|.| +||||||||||.+|++|+|||+|++|+|++
T Consensus         6 ~~I~Gv~~i~~~~f~D~RG~f~e~f~~~~~~~~~~~~~~~~~q~~~S~s-~kgvlRGlH~q~~p~~q~Klv~ci~G~I~~   84 (205)
T 1oi6_A            6 LAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMS-KRGVVRGIHYTVTPPGTAKYVYCARGKAMD   84 (205)
T ss_dssp             CSSTTCEEEECCCEEETTEEEECSCBHHHHHHHHSSCCCCCCEEEEEEE-CTTBEEEEEEECTTTCCCEEEEEEESCEEE
T ss_pred             CCCCCEEEEECCEEECCCCCEEEEECHHHHHHHCCCCCCCEEEEEEEEC-CCCEEEEEEEECCCCCCEEEEEEEEEEEEE
T ss_conf             5589669998931787992878764478999841898876006999883-598699996637878760787788618999


Q ss_pred             HHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCC
Q ss_conf             43340642133310011366236530233302322034530745338972178767101702168880117747888767
Q gi|254780919|r   79 IAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTI  158 (198)
Q Consensus        79 vvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~  158 (198)
                      |+||+|++|||||+|..++|+++++++|+||+||||||++|+|+|+++|++|++|+|++|.+|+|+||.|+|+||+..+ 
T Consensus        85 v~vD~R~~SpTfg~~~~~~L~~~~~~~l~IP~G~aHGf~~L~d~t~v~Y~~s~~y~p~~e~~i~~~Dp~l~i~Wp~~~~-  163 (205)
T 1oi6_A           85 IVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVE-  163 (205)
T ss_dssp             EEECCCBTCTTTTCEEEEEECSSSCCEEEECTTCEEEEEECSTTEEEEEEESSCCCGGGEEECCTTCTTTCCSCCCSSC-
T ss_pred             EEHHCCCCCCCCCCEEEEEECCCCCCEEEECCCCCEEEEECCCCCEEEEECCCCCCCCCCCEECCCCCCCCCCCCCCCC-
T ss_conf             9811036899767157776137899789968997579986367656688628756802460676798656867799998-


Q ss_pred             CCEECHHHHCCCCHHHCCCCCEE
Q ss_conf             63016788459987781855123
Q gi|254780919|r  159 LPSVSEKDQNLPFLNQIDSPFEY  181 (198)
Q Consensus       159 ~piiS~kD~~~p~l~d~~~~f~~  181 (198)
                       ||||+||+++|+|+|+++...+
T Consensus       164 -~iiS~kD~~~p~l~e~~~~~~~  185 (205)
T 1oi6_A          164 -PIVSDRDRVAITLAEAQRQGLL  185 (205)
T ss_dssp             -CBCCHHHHTCCCHHHHHHTTCS
T ss_pred             -CEECHHHCCCCCHHHHHHCCCC
T ss_conf             -6888899289998999866999