HHsearch results for GI: 254780919 and protein with PDBid: 1y3t_A

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*
Probab=91.90  E-value=0.14  Score=28.30  Aligned_cols=66  Identities=18%  Similarity=0.257  Sum_probs=46.1

Q ss_pred             CCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEE
Q ss_conf             20000000155555440121000022222343340642133310011366236530233302322034530745338972
Q gi|254780919|r   49 DCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK  128 (198)
Q Consensus        49 ~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~  128 (198)
                      .+|.-..+|.+..   ...+++|++|++... +|        +  ..+.|.+  +..++||+|..|+|...++++.+...
T Consensus        54 ~pG~~~~~h~H~~---~~e~~~vl~G~~~~~-~~--------~--~~~~l~~--Gd~~~~p~~~~H~~~n~~~~~~~~~~  117 (337)
T 1y3t_A           54 GKGDAFPLHVHKD---THEGILVLDGKLELT-LD--------G--ERYLLIS--GDYANIPAGTPHSYRMQSHRTRLVSY  117 (337)
T ss_dssp             CTTCEEEEEECTT---CCEEEEEEESCEEEE-ET--------T--EEEEECT--TCEEEECTTCCEEEEECSTTEEEEEE
T ss_pred             CCCCCCCCCCCCC---CEEEEEEEECEEEEE-EC--------C--EEEEECC--CCEEEECCCCCEEEEECCCCCEEEEE
T ss_conf             9999788668899---619999995889999-99--------9--9999718--98899489996899984898489999


Q ss_pred             EC
Q ss_conf             17
Q gi|254780919|r  129 VT  130 (198)
Q Consensus       129 ~~  130 (198)
                      ++
T Consensus       118 ~~  119 (337)
T 1y3t_A          118 TM  119 (337)
T ss_dssp             EE
T ss_pred             EC
T ss_conf             76