HHsearch results for GI: 254780919 and protein with PDBid: 2oa2_A

>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.41A {Bacillus halodurans}
Probab=93.87  E-value=0.066  Score=30.24  Aligned_cols=73  Identities=19%  Similarity=0.205  Sum_probs=48.7

Q ss_pred             CCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEE
Q ss_conf             25200000001555554401210000222223433406421333100113662365302333023220345307453389
Q gi|254780919|r   47 SFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI  126 (198)
Q Consensus        47 s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~  126 (198)
                      +..+|.-.|+|++..   ...+++|++|+....+-+-+     .-......+.+  +.+++||+|..|++...++....+
T Consensus        49 ~i~PG~~~~~H~H~~---~eE~~~Vl~G~~~v~~~~~~-----~~l~~~~~v~~--Gd~i~iP~g~~H~~~N~g~epl~~  118 (148)
T 2oa2_A           49 SIQVGEDIGLEIHPH---LDQFLRVEEGRGLVQMGHRQ-----DNLHFQEEVFD--DYAILIPAGTWHNVRNTGNRPLKL  118 (148)
T ss_dssp             EECTTCBCCCBCCTT---CEEEEEEEESEEEEEEESBT-----TBCCEEEEEET--TCEEEECTTCEEEEEECSSSCEEE
T ss_pred             EECCCCCCCCCCCCC---CCEEEEEECCCEEEEECCEE-----CCCCCEEECCC--CCEEEECCCCCEEEEECCCCCEEE
T ss_conf             999999986542989---77899998087999989881-----33430152189--989997999729979899899899


Q ss_pred             EEE
Q ss_conf             721
Q gi|254780919|r  127 YKV  129 (198)
Q Consensus       127 Y~~  129 (198)
                      +.+
T Consensus       119 l~i  121 (148)
T 2oa2_A          119 YSI  121 (148)
T ss_dssp             EEE
T ss_pred             EEE
T ss_conf             999