HHSEARCH alignment of GI: 254780919 and SCOP domain: d1dzra_

Alignment
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]}
Probab=100.00  E-value=0  Score=399.17  Aligned_cols=173  Identities=48%  Similarity=0.872  Sum_probs=165.4

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC-CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHH
Q ss_conf             965753997076220379504211088989867-9987413442331252000000015555544012100002222234
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDI   79 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~-~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dv   79 (198)
                      .+|+||++++++.|+|+||+|.|+|+.+.+.+. +.++.|+|+|+|.| +||||||||||.+|++|+|+|+|++|+|+||
T Consensus         7 t~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~~~~~~~~~q~n~S~s-~kgvlRGlH~q~~~~~q~Klv~~i~G~I~dv   85 (183)
T d1dzra_           7 TAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKS-KKNVLRGLHFQRGENAQGKLVRCAVGEVFDV   85 (183)
T ss_dssp             CSSTTCEEEECCEEEETTEEEEEEEEHHHHHHHHSSCCCCCEEEEEEE-ETTBEEEEEEECGGGCCCEEEEEEESEEEEE
T ss_pred             CCCCCEEEEECCCEECCCCCEEEEECHHHHHHHCCCCCCEEEEEEEEE-CCCEEEEEEECCCCCCHHHHEEECCCCEEEE
T ss_conf             569982999698246588277886313567774155751336677540-3425678886455201142304256638999


Q ss_pred             HHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             33406421333100113662365302333023220345307453389721787671017021688801177478887676
Q gi|254780919|r   80 AVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL  159 (198)
Q Consensus        80 vvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~  159 (198)
                      +||+|++|||||++.+++|+++++++|+||+||||||+||+++|+++|+++++|+|++|.||+|+||.++|+||+.+  .
T Consensus        86 vvDlR~~S~t~g~~~~~~L~~~~~~~l~IP~G~aHGf~~l~~~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~--~  163 (183)
T d1dzra_          86 AVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQ--L  163 (183)
T ss_dssp             EEECCTTCTTTTCEEEEEEETTTCCEEEECTTEEEEEEECSSEEEEEEEESSCCCTTTEEECCTTCTTTTCCCCCSS--C
T ss_pred             EEECCCCCCCCCCEEEEEECCCCCEEEEECCCEEEEEEEECCCCEEEEECCCCCCCCCCEEECCCCCCCCCCCCCCC--C
T ss_conf             98606899988807888604777459997698578998716831279968852284575256279943397899999--8


Q ss_pred             CEECHHHHCCCCHHHCC
Q ss_conf             30167884599877818
Q gi|254780919|r  160 PSVSEKDQNLPFLNQID  176 (198)
Q Consensus       160 piiS~kD~~~p~l~d~~  176 (198)
                      ||||+||+++|+|+|+-
T Consensus       164 ~ilS~kD~~~p~l~e~~  180 (183)
T d1dzra_         164 PELSAKDAAAPLLDQAL  180 (183)
T ss_dssp             CBCCHHHHTCCCGGGSC
T ss_pred             CEECHHHHCCCCHHHHH
T ss_conf             57788894799868964


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
species: Salmonella typhimurium [TaxId: 90371]