HHSEARCH alignment of GI: 254780919 and SCOP domain: d1j58a_

Alignment
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}
Probab=96.65  E-value=0.00062  Score=40.51  Aligned_cols=97  Identities=23%  Similarity=0.324  Sum_probs=64.4

Q ss_pred             ECCCEEEEEECHHHHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHHHHHHEEE
Q ss_conf             37950421108898986799874134423312520000000155555440121000022222343340642133310011
Q gi|254780919|r   16 DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVS   95 (198)
Q Consensus        16 D~RG~f~e~f~~~~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~SpTfgk~~~   95 (198)
                      .+.|+..+. +...|..+   ..+.-.+..+  ++|.+|-.|++..    +.+.+|++|+...-+||-      -|+...
T Consensus        53 ~~gg~~r~~-~~~~lp~~---~~~a~~~~~L--~pga~~~pH~H~~----ae~~yVl~G~~~vt~Vd~------~G~~~~  116 (372)
T d1j58a_          53 EKGGYAREV-TVRELPIS---ENLASVNMRL--KPGAIRELHWHKE----AEWAYMIYGSARVTIVDE------KGRSFI  116 (372)
T ss_dssp             ETTEEEEEE-CTTTCTTC---SSCEEEEEEE--CTTCEEEEEEESS----CEEEEEEEEEEEEEEECT------TSCEEE
T ss_pred             CCCCEEEEE-EHHHCHHH---HHHHHEEEEE--CCCCCCCCCCCCC----CCEEEEEECEEEEEEEEC------CCCEEE
T ss_conf             679714786-44438003---3110058998--8996768736376----438999957799999948------994899


Q ss_pred             EEEECCCCCEEEECCCCCEEEEEECCCCEEEEEEC
Q ss_conf             36623653023330232203453074533897217
Q gi|254780919|r   96 LEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVT  130 (198)
Q Consensus        96 ~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~  130 (198)
                      ..|.+  +..++||+|++|..+.+++.+.++-..+
T Consensus       117 ~~l~~--GDv~~~P~G~~H~i~n~~dg~e~l~vf~  149 (372)
T d1j58a_         117 DDVGE--GDLWYFPSGLPHSIQALEEGAEFLLVFD  149 (372)
T ss_dssp             EEEET--TEEEEECTTCCEEEEEEEEEEEEEEEES
T ss_pred             EEECC--CCEEEECCCCEEEEEECCCCCEEEEEEC
T ss_conf             88536--9889989997799971799958999977


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Oxalate decarboxylase OxdC (YvrK)
species: Bacillus subtilis [TaxId: 1423]