HHSEARCH alignment of GI: 254780919 and SCOP domain: d1nxma_

Alignment
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
Probab=100.00  E-value=0  Score=365.06  Aligned_cols=171  Identities=32%  Similarity=0.580  Sum_probs=152.8

Q ss_pred             CCCCEEEEECCEEEECCCEEEEEECHHHHHHCCCCCCE-----EEEEEEECCCCCEEEECCCCCCCCCHHHHEEEC-HHH
Q ss_conf             65753997076220379504211088989867998741-----344233125200000001555554401210000-222
Q gi|254780919|r    2 NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVF-----VQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI-AGR   75 (198)
Q Consensus         2 ~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~~~~~~~-----~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci-~G~   75 (198)
                      .|+||++++++.|+|+||+|.|+|+.+++.+++++..|     +|+|+|.| +||||||||||    +|+|+|+|+ .|+
T Consensus        14 ~I~Gv~ii~~~~f~D~RG~F~e~f~~~~~~~~~~~~~~~~~~~vQ~n~S~S-~kgvlRGlH~q----~~~k~v~~~~~G~   88 (194)
T d1nxma_          14 AIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFS-RKNVLRGLHAE----PWDKYISVADGGK   88 (194)
T ss_dssp             TSTTCEEEECCEEEETTEEEEEEEEHHHHTTTTCCGGGGTTCCCEEEEEEE-ETTBEEEEEEC----SSCEEEEECSSCC
T ss_pred             CCCCCEEEECCCCCCCCCCEEEHHHHHHHHHHCCCCCCCCCCEEEEEEEEE-EEEEEEEEEEC----CCHHHHHHCCCCC
T ss_conf             089858996985144996875466278999837984202121035667631-10089999721----2011232104231


Q ss_pred             HHHHHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHC---EECCCCCCCCCCCC
Q ss_conf             223433406421333100113662365302333023220345307453389721787671017---02168880117747
Q gi|254780919|r   76 IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHD---SGVAWQDKSIDITW  152 (198)
Q Consensus        76 I~dvvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e---~~i~~~Dp~l~i~W  152 (198)
                      |++|+||+|+ |||||+|..++|+++  ++||||+||||||+||+|+|+++|+||++|+|+.|   .+|+|+||+|+|+|
T Consensus        89 i~~V~vD~R~-S~t~g~~~~~~l~~~--~~i~IP~G~aHGf~tL~d~t~i~Y~~s~~y~~~~e~~~~~i~~~Dp~l~I~W  165 (194)
T d1nxma_          89 VLGTWVDLRE-GETFGNTYQTVIDAS--KSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKW  165 (194)
T ss_dssp             EEEEEEECBS-STTTTCEEEEEECTT--EEEEECTTEEEEEEECSSEEEEEEEESSCCCGGGGGGCEECCTTCTTSSCCC
T ss_pred             EEEEEEEECC-CCCCCEEEEEEECCC--CEEEEECCEEEEEEEECCCEEEEEECCCCCCCCCCCCCEEECCCCCCCCCCC
T ss_conf             0678887326-643100123450357--3589701211577762332267884576658323577235638993028899


Q ss_pred             CCCCCCCCEECHHHHCCCCHHHCCCCCEECC
Q ss_conf             8887676301678845998778185512356
Q gi|254780919|r  153 PLLDTILPSVSEKDQNLPFLNQIDSPFEYDG  183 (198)
Q Consensus       153 p~~~~~~piiS~kD~~~p~l~d~~~~f~~~~  183 (198)
                      |..+  .||||+||+++|+|+|++ ++.++.
T Consensus       166 p~~~--~~ilS~kD~~~p~l~d~~-~~~~~~  193 (194)
T d1nxma_         166 ENLE--EAEVSEADENHPFLKDVK-PLRKED  193 (194)
T ss_dssp             SCST--TCBCCHHHHTSCCGGGCC-CBCGGG
T ss_pred             CCCC--CCEECHHHCCCCCHHHCC-CCCCCC
T ss_conf             9999--788868891899957774-668455


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
species: Streptococcus suis [TaxId: 1307]