HHSEARCH alignment of GI: 254780919 and SCOP domain: d1oi6a_

Alignment
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]}
Probab=100.00  E-value=0  Score=400.66  Aligned_cols=176  Identities=28%  Similarity=0.483  Sum_probs=166.6

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC--CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHH
Q ss_conf             965753997076220379504211088989867--998741344233125200000001555554401210000222223
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFD   78 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~--~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~d   78 (198)
                      |+|+||++++|++|.|+||+|.|+|+.+.+.+.  +..+.|+|+|+|.| +||||||||||.+|++|+|||+|++|+|+|
T Consensus         6 ~~I~Gv~~i~p~~f~D~RG~f~e~f~~~~~~~~~~~~~~~~~Q~n~S~s-~k~vlRGlH~q~~~~~q~Klv~ci~G~i~d   84 (202)
T d1oi6a_           6 LAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMS-KRGVVRGIHYTVTPPGTAKYVYCARGKAMD   84 (202)
T ss_dssp             CSSTTCEEEECCCEEETTEEEECSCBHHHHHHHHSSCCCCCCEEEEEEE-CTTBEEEEEEECTTTCCCEEEEEEESCEEE
T ss_pred             CCCCCEEEEECCCEECCCCCEEEEHHHHHHHHHCCCCCCCEEEEHHHCC-HHHEEEEEEECCCCCCHHHEEEECCCCEEE
T ss_conf             5589669997942675897867502589999852899763541100022-110245312054322023302212461799


Q ss_pred             HHHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCC
Q ss_conf             43340642133310011366236530233302322034530745338972178767101702168880117747888767
Q gi|254780919|r   79 IAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTI  158 (198)
Q Consensus        79 vvvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~  158 (198)
                      |+||+|++|||||+|..++|+++++++|+||+||||||++|+|+|+++|+++++|+|++|.+|+|+||.|+|+||+..+ 
T Consensus        85 v~vD~R~~SpTfg~~~~~~L~~~~~~~l~IP~G~aHGf~~L~d~t~v~Y~~s~~y~p~~e~~i~~~Dp~l~i~W~~~~~-  163 (202)
T d1oi6a_          85 IVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVE-  163 (202)
T ss_dssp             EEECCCBTCTTTTCEEEEEECSSSCCEEEECTTCEEEEEECSTTEEEEEEESSCCCGGGEEECCTTCTTTCCSCCCSSC-
T ss_pred             EEEECCCCCCCCCEEEEEECCCCCCEEEEECCCEEEEEEECCCCCEEEEECCCCCCHHCCEEECCCCCCCCCCCCCCCC-
T ss_conf             9974345777520134553121214047863424578842265004688458765841171775698546877899997-


Q ss_pred             CCEECHHHHCCCCHHHCCCCC
Q ss_conf             630167884599877818551
Q gi|254780919|r  159 LPSVSEKDQNLPFLNQIDSPF  179 (198)
Q Consensus       159 ~piiS~kD~~~p~l~d~~~~f  179 (198)
                       ||||+||+++|+|+|++...
T Consensus       164 -~iiS~kD~~~p~l~e~~~~~  183 (202)
T d1oi6a_         164 -PIVSDRDRVAITLAEAQRQG  183 (202)
T ss_dssp             -CBCCHHHHTCCCHHHHHHTT
T ss_pred             -CEECHHHCCCCCHHHHHHCC
T ss_conf             -67778890899989998669


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD
species: Amycolatopsis orientalis [TaxId: 31958]