HHSEARCH alignment of GI: 254780919 and SCOP domain: d1uija1

Alignment
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
Probab=92.56  E-value=0.15  Score=26.81  Aligned_cols=93  Identities=20%  Similarity=0.168  Sum_probs=57.4

Q ss_pred             EEEECCCEEEEE--ECHH--HHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCHH
Q ss_conf             220379504211--0889--898679987413442331252000000015555544012100002222234334064213
Q gi|254780919|r   13 KFEDSRGWFSQT--YSSK--LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSP   88 (198)
Q Consensus        13 ~f~D~RG~f~e~--f~~~--~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~Sp   88 (198)
                      +++.+-|.+..+  |...  .+..++ +..+....    .++|.++-.|+..    -..+++|++|+...-+|+-     
T Consensus        17 ~~~~~~G~i~~~~~~~~~~~~l~~l~-~~~v~~~~----i~p~~~~~Ph~~~----a~ei~yV~~G~g~v~~v~~-----   82 (170)
T d1uija1          17 LFENQNGRIRLLQRFNKRSPQLENLR-DYRIVQFQ----SKPNTILLPHHAD----ADFLLFVLSGRAILTLVNN-----   82 (170)
T ss_dssp             EEECSSEEEEEECCHHHHCGGGGGGT-TCEEEEEE----ECTTEEEEEEEES----EEEEEEEEESCEEEEEECS-----
T ss_pred             CCCCCCCCEEEEECCCCCCHHHCCHH-HEEEEEEE----ECCCCCCCCCCCC----CCEEEEEEEEEEEEEEEEC-----
T ss_conf             41369971899823666562204510-05789999----6489533144699----8789999997999999938-----


Q ss_pred             HHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCC
Q ss_conf             33100113662365302333023220345307453
Q gi|254780919|r   89 TYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT  123 (198)
Q Consensus        89 Tfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~  123 (198)
                        +...++.|.  .+..++||+|..|..+...++.
T Consensus        83 --~~~~~~~l~--~GDv~~vP~G~~h~~~n~~~~~  113 (170)
T d1uija1          83 --DDRDSYNLH--PGDAQRIPAGTTYYLVNPHDHQ  113 (170)
T ss_dssp             --SCEEEEEEC--TTEEEEECTTCEEEEEECCSSC
T ss_pred             --CCCEEEEEC--CCCEEEECCCCEEEEEECCCCC
T ss_conf             --983899832--8968998999728999759997


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]