HHSEARCH alignment of GI: 254780919 and SCOP domain: d1uika1

Alignment
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
Probab=92.66  E-value=0.048  Score=29.65  Aligned_cols=93  Identities=14%  Similarity=0.168  Sum_probs=59.2

Q ss_pred             CEEEECCCEEEEE--ECHH--HHHHCCCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHHHHHCCCCH
Q ss_conf             6220379504211--0889--89867998741344233125200000001555554401210000222223433406421
Q gi|254780919|r   12 RKFEDSRGWFSQT--YSSK--LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNS   87 (198)
Q Consensus        12 ~~f~D~RG~f~e~--f~~~--~~~~~~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dvvvDlR~~S   87 (198)
                      .+|+.+-|.+..+  |+..  .+..+ ..+....  +  +.++|.+.-.|+..    -..+++|++|+...-+++-    
T Consensus        12 ~~~~~~~G~i~~~~~~~~~~~~l~~l-~~~~v~~--~--~i~p~~l~~Ph~~~----a~ev~yV~~G~g~~~~v~~----   78 (203)
T d1uika1          12 TLFKNQYGHVRVLQRFNKRSQQLQNL-RDYRILE--F--NSKPNTLLLPHHAD----ADYLIVILNGTAILTLVNN----   78 (203)
T ss_dssp             EEEECSSEEEEEECCTTSSCGGGGGG-TTCEEEE--E--EECSSEEEEEEEES----EEEEEEEEESEEEEEEECS----
T ss_pred             CCEECCCCEEEEECCCCCCCHHHCCC-CCEEEEE--E--EECCCCCCCCCCCC----CCEEEEEEEEEEEEEEEEC----
T ss_conf             84388997699955667654432442-2228999--9--94699725101499----8689999887999999918----


Q ss_pred             HHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCC
Q ss_conf             33310011366236530233302322034530745
Q gi|254780919|r   88 PTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN  122 (198)
Q Consensus        88 pTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~  122 (198)
                         ++..++.|.+  +..++||+|++|-.+...++
T Consensus        79 ---~~~~~~~l~~--GDv~~iP~G~~~~~~N~~~~  108 (203)
T d1uika1          79 ---DDRDSYNLQS--GDALRVPAGTTYYVVNPDND  108 (203)
T ss_dssp             ---SCEEEEEEET--TEEEEECTTCEEEEEECCSS
T ss_pred             ---CCEEEEEECC--CCEEEECCCCEEEEEECCCC
T ss_conf             ---9738998428--87899889976999977999


SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]