BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose
3,5-epimerase [Candidatus Liberibacter asiaticus str. psy62]
         (198 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040596|gb|ACT57392.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 198

 Score =  414 bits (1063), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/198 (100%), Positives = 198/198 (100%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR
Sbjct: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE
Sbjct: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
           MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE
Sbjct: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180

Query: 181 YDGLPLLSLNMERDLLCV 198
           YDGLPLLSLNMERDLLCV
Sbjct: 181 YDGLPLLSLNMERDLLCV 198


>gi|315122655|ref|YP_004063144.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496057|gb|ADR52656.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 199

 Score =  317 bits (811), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 170/196 (86%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           INPVRILKT+  ED RGWFS+TY+    K+ G +DVFVQDNHSFS + GTIRGLHFQ+PP
Sbjct: 4   INPVRILKTKILEDDRGWFSETYNDNCFKKNGFKDVFVQDNHSFSLNTGTIRGLHFQKPP 63

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAK+VRC++GRIFD+AVD+R++SPTYG W+SLEISA++GLQIYIP GFAHGFMTLE N
Sbjct: 64  HAQAKIVRCVSGRIFDVAVDVRKDSPTYGNWISLEISASSGLQIYIPIGFAHGFMTLEPN 123

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           TEVIYKVTDFYS  HDSGV WQDKSI I WPLL+ + PS+S+KD NLPFLNQ+DSPF YD
Sbjct: 124 TEVIYKVTDFYSSSHDSGVLWQDKSIGIRWPLLEKVSPSLSDKDMNLPFLNQLDSPFTYD 183

Query: 183 GLPLLSLNMERDLLCV 198
           G PLL L+M+RD+ CV
Sbjct: 184 GFPLLPLDMDRDMSCV 199


>gi|254500091|ref|ZP_05112243.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Labrenzia alexandrii DFL-11]
 gi|222441389|gb|EEE48067.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Labrenzia alexandrii DFL-11]
          Length = 192

 Score =  224 bits (572), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 135/187 (72%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V ++  R+F D RGWF+++Y+ + L+ LG+   FVQDNHS S   GT+RGLHFQ PP+AQ
Sbjct: 5   VTLIHPRRFGDDRGWFTESYNKQKLEPLGITCDFVQDNHSLSVPTGTLRGLHFQTPPFAQ 64

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRCI G++FD+AVDIR+ SPTYG WV +E+SA NG Q+ +P G+AHGF+TLE NTEV
Sbjct: 65  DKLVRCIRGKVFDVAVDIRKGSPTYGKWVGVELSAENGDQLLVPAGYAHGFVTLEDNTEV 124

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLP 185
            YKV+++YS ++D+G+ W D  I I WPL     P +S KD   P L   DSPF+YDG P
Sbjct: 125 TYKVSNYYSPQNDAGLMWDDADIGIDWPLAAGAEPILSGKDTQHPGLADFDSPFDYDGTP 184

Query: 186 LLSLNME 192
           +  + +E
Sbjct: 185 MTLVEIE 191


>gi|302382272|ref|YP_003818095.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192900|gb|ADL00472.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 205

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (71%), Gaps = 1/182 (0%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           + ++R+F D RGWF++TYS + L + G+ D FVQDN S S   GT+RG+HFQRPP+AQAK
Sbjct: 22  LYESRRFGDDRGWFTETYSERALADRGVSDRFVQDNQSLSIAPGTVRGIHFQRPPFAQAK 81

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVRC+ GRI D AVD+RR SPTYG WVS E++A+NGLQ+Y+P G+ H F+TLE  TEV+Y
Sbjct: 82  LVRCLRGRIMDYAVDLRRGSPTYGDWVSAELTADNGLQLYVPVGYGHAFVTLEPRTEVVY 141

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLL 187
           KV   Y+ + D G+ W D  I I W L  +  P +SEKD+ LP L   DSPF+YDG PL 
Sbjct: 142 KVNAVYAADCDGGIVWDDPDIGIEWSLPPSG-PLLSEKDRQLPRLADFDSPFDYDGRPLE 200

Query: 188 SL 189
            L
Sbjct: 201 PL 202


>gi|312115798|ref|YP_004013394.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220927|gb|ADP72295.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 196

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/176 (53%), Positives = 129/176 (73%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++ R+FED RGWFS+TY+ +  ++ GL+  FVQDNHS S +  T+RGLHFQRPP+AQ
Sbjct: 5   VLLIRPRRFEDDRGWFSETYNERNFRQAGLESRFVQDNHSLSREKYTLRGLHFQRPPFAQ 64

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVRC  GRIFD+ VDIR  SP++G W+S E+SA  G Q+++P GF HGF+TL  +TE+
Sbjct: 65  SKLVRCSKGRIFDVTVDIRIGSPSFGGWISTELSAEGGEQLFVPAGFLHGFLTLTPDTEI 124

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           IYKV+DFY    D+GV W D  I + W L + + P++S KD+ LP L  IDSPF +
Sbjct: 125 IYKVSDFYDGASDAGVRWDDPMIAVNWSLPEGVPPTLSAKDRALPLLAAIDSPFMF 180


>gi|148556919|ref|YP_001264501.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas wittichii RW1]
 gi|148502109|gb|ABQ70363.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas wittichii RW1]
          Length = 185

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 1/185 (0%)

Query: 5   PVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           PV+++ TR+F D RGWFS+TY        G  + FVQDNHS+S   GT+RG+HFQ PP+A
Sbjct: 2   PVKLIHTRRFGDDRGWFSETYHRPRWTADGAAEEFVQDNHSYSKHAGTLRGIHFQAPPHA 61

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           QAKLVRCI GRI D AVD+R  SPTYG  V+ E+SA+NG Q+YIP GF H F+TLE ++E
Sbjct: 62  QAKLVRCIRGRILDYAVDLRAGSPTYGRHVAAELSADNGDQLYIPVGFGHAFVTLEPDSE 121

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
           VIYKV+D Y+ + D G++W   ++ I WPL     P +S+KD+ LP L   DSPF YDG 
Sbjct: 122 VIYKVSDVYAPDVDGGISWDCPTLAIDWPLPPG-GPVLSDKDRTLPHLADWDSPFAYDGA 180

Query: 185 PLLSL 189
           PL  L
Sbjct: 181 PLRPL 185


>gi|90425680|ref|YP_534050.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           BisB18]
 gi|90107694|gb|ABD89731.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           BisB18]
          Length = 184

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/180 (53%), Positives = 125/180 (69%), Gaps = 2/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NI  V +L  ++F D RGWF +TYS   L+ LG++  FVQDNHS S   GT+RGLHFQ 
Sbjct: 6   LNIPGVVVLTPKRFADDRGWFMETYSHPALQALGIELDFVQDNHSLSLHTGTLRGLHFQT 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQAKLVRC+ GRI D+AVD+R NSPTYG + S E+SA +  QI+IP GFAHGF+TLE
Sbjct: 66  PPHAQAKLVRCVRGRILDVAVDVRANSPTYGQYASAELSAADARQIFIPVGFAHGFVTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +TEV+YKV+D Y+ + D G+ W D +I   W +     P +S KD+ LP L    SPF 
Sbjct: 126 PDTEVVYKVSDIYAPQCDGGIRWNDPTIAFPWNIEHG--PFLSPKDEKLPLLADFVSPFR 183


>gi|316935627|ref|YP_004110609.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           DX-1]
 gi|315603341|gb|ADU45876.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           DX-1]
          Length = 184

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V++L  R+F D RGWFS++Y+ K L +  +   FVQDNHS+S   GTIRG HFQ 
Sbjct: 6   LDIPGVKLLSPRRFSDDRGWFSESYNQKTLAQFDIHWQFVQDNHSYSKHAGTIRGFHFQA 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRC+ G I DIAVD+R  SPTY  WV+ E+SA NG Q+++P GFAH F+TL+
Sbjct: 66  PPHAQDKLVRCVRGSIVDIAVDLRAGSPTYAKWVAAELSAENGEQLFVPVGFAHAFITLQ 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            +TEV+YKVT FY+ E D GV W D +I   W L     P +S KD  LP L  I++PF
Sbjct: 126 PDTEVLYKVTSFYAPESDGGVRWDDPTIGFPWKLPQGA-PHLSAKDAKLPRLQDIETPF 183


>gi|195953910|ref|YP_002122200.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1]
 gi|195933522|gb|ACG58222.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1]
          Length = 190

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 129/183 (70%), Gaps = 2/183 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V ++K + F+D RG+F ++Y     ++ G+ D+F+QDNHS S   G +RGLH+Q+ 
Sbjct: 9   DIKEVILIKPKVFKDERGFFLESYKKSEFEKNGITDIFIQDNHSKSVK-GVLRGLHYQKE 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRCI G+IFD+AVDIR+NSPTYG WV  E+S  N L ++IP GFAHGF+TL  
Sbjct: 68  PEAQGKLVRCIKGKIFDVAVDIRKNSPTYGRWVGYELSEENKLMLFIPKGFAHGFLTLSE 127

Query: 122 NTEVIYKVTDF-YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E+IYKV++  YS EHD G+ W DK+I+I WPL +     +S+KD+NLP L Q D+ F 
Sbjct: 128 EAEIIYKVSEAEYSKEHDKGIIWNDKTINIKWPLENIKEVILSDKDKNLPTLEQADNNFL 187

Query: 181 YDG 183
           Y G
Sbjct: 188 YGG 190


>gi|83955938|ref|ZP_00964449.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. NAS-14.1]
 gi|83839702|gb|EAP78880.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. NAS-14.1]
          Length = 198

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 124/179 (69%), Gaps = 1/179 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I+   +F D RG+FS++YS+K L E G+   FVQDNHS S   GTIRGLHFQ PP+AQ
Sbjct: 21  VIIITPARFGDHRGFFSESYSAKALAEHGITTQFVQDNHSLSMTQGTIRGLHFQVPPHAQ 80

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G +FD+AVDIR+ SPTYG W  +E+S  NG Q+ +P GFAHGF+T    TE+
Sbjct: 81  DKLVRCGRGALFDVAVDIRKGSPTYGQWFGVELSFENGKQLLVPAGFAHGFVTRAPETEI 140

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
           IYK +D+Y+ E +  VAW D  + I W L + I P +SEKD N P L  ++SPF ++G+
Sbjct: 141 IYKCSDYYAQETEGAVAWDDPQVGIDWGLGE-IAPVLSEKDANAPSLAALNSPFTFEGV 198


>gi|195953941|ref|YP_002122231.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1]
 gi|195933553|gb|ACG58253.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1]
          Length = 190

 Score =  201 bits (511), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 2/183 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V ++K + F+D RG+F ++Y     ++ G+ D+F+QDNHS S   G +RGLH+Q+ 
Sbjct: 9   DIKEVILIKPKVFKDERGFFLESYKKSEFEKNGITDIFIQDNHSKSVK-GVLRGLHYQKE 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL+RCI G+IFD+AVDIR+NSPTYG WV  E+S  N L ++IP GFAHGF+TL  
Sbjct: 68  PAAQGKLIRCIKGKIFDVAVDIRKNSPTYGGWVGYELSEENKLMLFIPKGFAHGFLTLSE 127

Query: 122 NTEVIYKVTDF-YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E+IYKV++  YS EHD G+ W DK+I I WPL       +S+KD+NLP L Q D+ F 
Sbjct: 128 EAEIIYKVSEAEYSKEHDKGIIWNDKTISIKWPLEHIKEIILSDKDKNLPTLEQADNNFL 187

Query: 181 YDG 183
           Y G
Sbjct: 188 YGG 190


>gi|83944595|ref|ZP_00957045.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. EE-36]
 gi|83844572|gb|EAP82459.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. EE-36]
          Length = 190

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 125/179 (69%), Gaps = 1/179 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V ++   +F D RG+FS++YS++ L E G+   FVQDNHS S   GTIRGLHFQ PP+AQ
Sbjct: 13  VIVITPARFGDYRGFFSESYSAEALAEHGITTPFVQDNHSLSMTQGTIRGLHFQAPPHAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G +FD+AVDIR+ SPTYG W  +E+S  NG Q+ +P GFAHGF+T    TE+
Sbjct: 73  DKLVRCGRGALFDVAVDIRKGSPTYGQWFGVELSFENGKQLLVPAGFAHGFVTRAPETEI 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
           +YK +D+Y+ E +  VAW D ++ I W L D + P +SEKD N P L  ++SPF ++G+
Sbjct: 133 VYKCSDYYARETEGAVAWDDPAVGIDWGLGD-MTPVLSEKDANAPALADLNSPFTFEGV 190


>gi|170288107|ref|YP_001738345.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermotoga sp. RQ2]
 gi|33413323|emb|CAD67948.1| putative dTDP-6-deoxy-D-glucose-3,5-epimerase [Thermotoga sp. RQ2]
 gi|170175610|gb|ACB08662.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermotoga sp. RQ2]
          Length = 188

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/176 (53%), Positives = 119/176 (67%), Gaps = 3/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ R FED RGWF ++YS ++ KELG+  VFVQDNHS+S   GT+RG+HFQ  P AQ
Sbjct: 11  VLIIEPRVFEDERGWFMESYSYRVFKELGIDVVFVQDNHSYSKKKGTLRGIHFQNDPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVRC  GRI D+AVD+R+ SPTY  W+ LE+S  N   ++IP GF H F+TL  + EV
Sbjct: 71  SKLVRCTRGRILDVAVDLRKGSPTYKKWIMLELSEENKRMLFIPRGFGHAFLTLTDDVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV  +YS EHD  + W D  I I WP+ D IL   SEKD+N PFL   D  F Y
Sbjct: 131 QYKVDQYYSKEHDRSIRWNDPDIGIDWPIKDPIL---SEKDRNAPFLKDSDCNFIY 183


>gi|222099006|ref|YP_002533574.1| Putative dTDP-6-deoxy-D-glucose-3,5-epimerase [Thermotoga
           neapolitana DSM 4359]
 gi|221571396|gb|ACM22208.1| Putative dTDP-6-deoxy-D-glucose-3,5-epimerase [Thermotoga
           neapolitana DSM 4359]
          Length = 188

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 120/178 (67%), Gaps = 3/178 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ R FED RGWF ++YS ++ KELG+  VFVQDNHS+S   GT+RG+HFQ  P AQ
Sbjct: 11  VLIIEPRVFEDERGWFMESYSYRVFKELGIDAVFVQDNHSYSKRKGTLRGIHFQNNPVAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G+I D+AVD+R+ SPTY  W+ +E+S  N   ++IP GF H F+TL  + EV
Sbjct: 71  AKLVRCTRGKILDVAVDLRKGSPTYKKWIMVELSEENKRMLFIPKGFGHAFLTLTDDVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
            YKV  +YS EHD  + W D  I I WP+ + IL   SEKD+N PFL   D  F Y G
Sbjct: 131 QYKVDQYYSKEHDRSIRWNDPDIGIDWPIEEPIL---SEKDRNAPFLKDSDCNFVYGG 185


>gi|126741092|ref|ZP_01756774.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseobacter sp. SK209-2-6]
 gi|126717856|gb|EBA14576.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseobacter sp. SK209-2-6]
          Length = 197

 Score =  197 bits (500), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 95/177 (53%), Positives = 126/177 (71%), Gaps = 4/177 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           ++IL+  +F D+RG+FS++++ + ++E G+   FVQDNHS S + GT+RGLHFQ PP+AQ
Sbjct: 22  LKILEPARFGDARGFFSESWNQRRMQEHGIDLDFVQDNHSLSSEVGTLRGLHFQSPPHAQ 81

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  GR+FD+AVDIR+ SPTYG W   E+S +NGLQ+ IP GF HGF+T E +TE+
Sbjct: 82  AKLVRCGRGRLFDVAVDIRKGSPTYGKWFGTELSFDNGLQLLIPAGFLHGFITREPDTEI 141

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           IYK TD+Y+ E D  VAW   S DI W    T  P +S+KD   P L   DSPF Y+
Sbjct: 142 IYKCTDYYAPECDGAVAWD--SCDIDWGFEGT--PMLSDKDAAAPKLADFDSPFTYE 194


>gi|163793777|ref|ZP_02187751.1| dTDP-4-dehydrorhamnose 3,5-epimerase [alpha proteobacterium BAL199]
 gi|159180888|gb|EDP65405.1| dTDP-4-dehydrorhamnose 3,5-epimerase [alpha proteobacterium BAL199]
          Length = 185

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 120/175 (68%), Gaps = 1/175 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V+I++ +KF D RG+FS+TYS    +   L   FVQDNHS S   G +RGLHFQ 
Sbjct: 6   LAIPDVKIIRPKKFGDHRGFFSETYSKPAFEAADLHLDFVQDNHSLSAASGVLRGLHFQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KL+R + GRIFD+AVDIR  S TYG WVS EISA    QI +P GFAHGF+TLE
Sbjct: 66  PPFAQDKLLRVVRGRIFDVAVDIRHGSATYGQWVSAEISAEEWNQILVPIGFAHGFVTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            +TEVIYKVT  Y+ EHD G+AW D  + I WP L+ I P++SEKD   P L  +
Sbjct: 126 PDTEVIYKVTAPYAPEHDRGIAWDDPDLGIAWP-LEGIEPTLSEKDTRHPRLADL 179


>gi|110635095|ref|YP_675303.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mesorhizobium sp. BNC1]
 gi|110286079|gb|ABG64138.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chelativorans sp. BNC1]
          Length = 189

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 124/181 (68%), Gaps = 2/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M +  V+ +   KF D RG+FS+TY++K   E G+   FVQDNHS S   GT+RGLHFQ+
Sbjct: 7   MELEGVQEILPEKFSDERGFFSETYNAKAFAEAGIAVEFVQDNHSLSSVPGTVRGLHFQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR + G I D+AVDIR  SPT+G WV +E+S+    Q++IP G+AHGFMTLE
Sbjct: 67  PPFAQDKLVRVVRGAILDVAVDIRAGSPTFGRWVGVELSSRKWNQLFIPKGYAHGFMTLE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +TEV+YKV+ FYS EHD  + + D +I I WP    I P +S KD+  P L ++++ F 
Sbjct: 127 PDTEVVYKVSAFYSREHDQAIRFDDPAIGIAWP--KEIKPLLSGKDRAAPDLAEVETGFR 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|83950202|ref|ZP_00958935.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius nubinhibens ISM]
 gi|83838101|gb|EAP77397.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius nubinhibens ISM]
          Length = 180

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL  R+F D+RG+FS++++ ++++E G++  FVQDNHS S D GT+RGLHFQ PP+AQ
Sbjct: 4   VLILTPRRFADARGFFSESWNQRVMEEAGIEIAFVQDNHSLSRDVGTVRGLHFQSPPHAQ 63

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G ++D+AVD+RR SP+YG WV +E+SA+NG Q+ IP GF HGF+T E +TEV
Sbjct: 64  AKLVRCGRGALYDVAVDVRRGSPSYGKWVGVELSADNGRQLLIPAGFLHGFVTREPDTEV 123

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYK +DFY+ E D  V + D  + I W  ++     +S+KD+        D+PF ++G
Sbjct: 124 IYKCSDFYAPECDGAVRFDDPDLGIDWG-IEASAAVLSDKDRAAQSFAAFDTPFVWEG 180


>gi|228961527|ref|ZP_04123137.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228798145|gb|EEM45148.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 186

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 2/180 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V++++ + F D RGWF +T+S + ++E G+   FVQDN SFS   GT+RGLH+Q  
Sbjct: 7   NLLGVKVIEPKVFGDHRGWFMETFSDQAMREAGIDLKFVQDNQSFSATKGTLRGLHYQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRC  G IFD+AVDIR+ SPTYG W  +E+SA N  Q+ IP GFAHGFMTL  
Sbjct: 67  PKAQTKLVRCTRGSIFDVAVDIRKGSPTYGQWFGIELSAENKKQLLIPKGFAHGFMTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           + EV YKV + Y+ E+D G+ W D  + + WP+   I P +SEKD+  P L + ++ F Y
Sbjct: 127 DVEVQYKVDELYAPEYDRGIIWNDAEVGVEWPM--EIQPVLSEKDEKAPSLKEAENNFVY 184


>gi|118588016|ref|ZP_01545426.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stappia aggregata IAM 12614]
 gi|118439638|gb|EAV46269.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stappia aggregata IAM 12614]
          Length = 192

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 5/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  VRIL  ++  DSRG+FS+TY+  LL + G+   F+QDNH++S + GT+RGLH+Q 
Sbjct: 7   LDIPEVRILCPKRHGDSRGFFSETYNKALLSDAGIDIDFIQDNHAYSAEKGTVRGLHYQM 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR + G I D+AVD+R  SPTYG  VS  ISA NG QI +PTGFAHG +TLE
Sbjct: 67  PPFAQDKLVRVVRGAILDVAVDLRVGSPTYGQHVSSVISAENGKQILVPTGFAHGLVTLE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSP 178
            +TEV+YKV+ +Y+ EHD G+ W D  + I W L   D +L   S KD+ LP L ++ + 
Sbjct: 127 PHTEVLYKVSQYYAPEHDRGILWNDPELAIDWGLAEADAVL---SPKDRKLPRLAEVAAC 183

Query: 179 FEY 181
           F Y
Sbjct: 184 FSY 186


>gi|118593889|ref|ZP_01551247.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stappia aggregata IAM 12614]
 gi|118433510|gb|EAV40179.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stappia aggregata IAM 12614]
          Length = 188

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 5/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  VRIL  ++  DSRG+FS+TY+  LL + G+   F+QDNH++S + GT+RGLH+Q 
Sbjct: 7   LDIPEVRILCPKRHGDSRGFFSETYNKALLSDAGIDIDFIQDNHAYSAEKGTVRGLHYQM 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR + G I D+AVD+R  SPTYG  VS  ISA NG QI +PTGFAHG +TLE
Sbjct: 67  PPFAQDKLVRVVRGAILDVAVDLRVGSPTYGQHVSSVISAENGKQILVPTGFAHGLVTLE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSP 178
            +TEV+YKV+ +Y+ EHD G+ W D  + I W L   D +L   S KD+ LP L ++ + 
Sbjct: 127 PHTEVLYKVSQYYAPEHDRGILWNDPELAIDWGLAEADAVL---SPKDRKLPRLAEVAAC 183

Query: 179 FEY 181
           F Y
Sbjct: 184 FSY 186


>gi|84515472|ref|ZP_01002834.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Loktanella vestfoldensis
           SKA53]
 gi|84510755|gb|EAQ07210.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Loktanella vestfoldensis
           SKA53]
          Length = 200

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 120/178 (67%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL   +F D+RG+FS++++ K L   G+   FVQDNHS S   GTIRGLHFQ PP+AQ
Sbjct: 23  VLILSPARFGDARGFFSESWNRKTLAAQGITLDFVQDNHSLSAQIGTIRGLHFQSPPHAQ 82

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G +FD+AVDIRR+SPTYG W+  E+S  NG Q+ IP GF HGF+T   +TE+
Sbjct: 83  AKLVRCGRGCLFDVAVDIRRDSPTYGQWLGEELSDQNGRQLLIPAGFLHGFITRAPDTEI 142

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYK TD+Y+   D  V + D  I I W L   + P +S+KD   P L  +D+PF ++G
Sbjct: 143 IYKCTDYYAPACDGAVRFDDPDIGIDWGLPAGVAPILSDKDAAAPLLRDLDTPFVFEG 200


>gi|306842189|ref|ZP_07474858.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO2]
 gi|306287776|gb|EFM59207.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO2]
          Length = 183

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 91/172 (52%), Positives = 121/172 (70%), Gaps = 1/172 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V  +  RKF D RG+FS+TY++K   E G+   FVQDNHS+S   G +RGLH+Q 
Sbjct: 6   LGLDGVFEISPRKFGDDRGFFSETYNAKSFAEAGIDLTFVQDNHSYSAAKGVVRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR   G I D+AVDIR++SPT+G WV+LE+SA+   QI +P GFAHGFMTL 
Sbjct: 66  PPFAQDKLVRVTRGAILDVAVDIRKSSPTFGKWVALEVSADKWNQILVPKGFAHGFMTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            NTEVIYKVTD+YS EHD  + + D +I I WP+  + +  +S+KDQ  P  
Sbjct: 126 ENTEVIYKVTDYYSPEHDRSIRFDDPAIGIDWPVASSGV-QLSDKDQKAPLF 176


>gi|296505692|ref|YP_003667392.1| glucose-1-phosphate thymidylyltransferase [Bacillus thuringiensis
           BMB171]
 gi|296326744|gb|ADH09672.1| glucose-1-phosphate thymidylyltransferase [Bacillus thuringiensis
           BMB171]
          Length = 186

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 119/180 (66%), Gaps = 2/180 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V++++ + F D RGWF +T+S + ++E G+   FVQDN SFS   GT+RGLH+Q  
Sbjct: 7   NLLGVKVIEPKVFGDHRGWFMETFSDQAMREAGIDLQFVQDNQSFSATKGTLRGLHYQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRC  G IFD+AVDIR+ SPTYG W  +E+SA N  Q+ IP GFAHGFMTL  
Sbjct: 67  PKAQTKLVRCTRGSIFDVAVDIRKGSPTYGQWFGIELSAENKKQLLIPKGFAHGFMTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           + EV YKV + Y+ E D G+ W D  + I WP+   I P +SEKD+  P L + +  F Y
Sbjct: 127 DVEVQYKVDELYAPECDRGIIWNDAEVGIEWPM--EIQPVLSEKDEKAPSLKEAEKNFVY 184


>gi|119384854|ref|YP_915910.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paracoccus denitrificans
           PD1222]
 gi|119374621|gb|ABL70214.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paracoccus denitrificans
           PD1222]
          Length = 193

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/179 (52%), Positives = 122/179 (68%), Gaps = 5/179 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQ-DVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V +L  R+F D RG+F +++S K L + GL    FVQDNHS S   GT+RGLHFQ PP+A
Sbjct: 11  VLVLVPRRFGDERGFFCESWSRKTLHDAGLDLPEFVQDNHSLSAAAGTLRGLHFQAPPHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC  GR+FD+AVDIR+ SP+YG W   E+S  NG Q++IP GF HGF+T E +TE
Sbjct: 71  QGKLVRCGRGRLFDVAVDIRKGSPSYGRWTGCELSFENGRQLWIPPGFLHGFVTREPDTE 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           ++YK TD+Y+ + D  VAW   SI I W +  +  P +S KD   P LN+ DSPF Y+G
Sbjct: 131 ILYKCTDYYAPDCDGAVAWD--SIGIDWGV--SGQPILSAKDAGAPVLNEFDSPFTYEG 185


>gi|254420592|ref|ZP_05034316.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas sp. BAL3]
 gi|196186769|gb|EDX81745.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas sp. BAL3]
          Length = 170

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/167 (55%), Positives = 116/167 (69%), Gaps = 1/167 (0%)

Query: 23  QTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVD 82
           +TYS       G+   FVQDN SFS   GTIRGLHFQRPP+AQAKLVRC+ G I D AVD
Sbjct: 2   ETYSEASATAAGVNARFVQDNQSFSAFQGTIRGLHFQRPPHAQAKLVRCVRGSIMDYAVD 61

Query: 83  IRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVA 142
           IRR SPTYG  V+ +++A  G Q+++P GFAH F+TLE + EV YKV+D Y+ + D G+ 
Sbjct: 62  IRRGSPTYGQHVAAKLTAVGGEQLFVPVGFAHAFVTLEPDVEVAYKVSDVYAPDCDGGIV 121

Query: 143 WQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSL 189
           W D  I I WPL ++    +S+KD+ LP L + DSPFEYDGLPL  L
Sbjct: 122 WSDPIIGIDWPLPESGA-VLSDKDKILPTLAEFDSPFEYDGLPLAPL 167


>gi|16519754|ref|NP_443874.1| dTDP-rhamnose 3,5-epimerase RmlC [Sinorhizobium fredii NGR234]
 gi|2500163|sp|P55468|RMLC_RHISN RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|2182415|gb|AAB91686.1| dTDP-rhamnose 3,5-epimerase RmlC [Sinorhizobium fredii NGR234]
          Length = 195

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 121/181 (66%), Gaps = 2/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V++++ RKF D RG+FS+ +  K  ++       VQDN S S   GT+RGLHFQ 
Sbjct: 14  LSIAEVKLIRPRKFGDCRGYFSEVFREKWFRKNVADVGLVQDNESLSAQIGTVRGLHFQL 73

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC  G +FD+AVD+R  SPTYG WVS E+S  NG Q+++P GFAHGFMTL+
Sbjct: 74  EPFAQGKLVRCTRGALFDVAVDVRVGSPTYGKWVSAELSQENGAQLWVPAGFAHGFMTLK 133

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T + YKVT  YS EHD G+ W D +I I WP + T +  +SEKD + P L ++   F+
Sbjct: 134 ADTVISYKVTAPYSAEHDRGLKWDDPAIGINWPKMTTYV--LSEKDSSQPSLCELPVSFQ 191

Query: 181 Y 181
           Y
Sbjct: 192 Y 192


>gi|254462855|ref|ZP_05076271.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679444|gb|EDZ43931.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 189

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 3/173 (1%)

Query: 12  RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRC 71
           ++F D RG+F ++YS +  +++GL   FVQDN+S S   GT+RGLHFQ PP+AQ KLVRC
Sbjct: 19  QRFGDERGFFCESYSKRRFEDIGLSFDFVQDNYSISAKAGTVRGLHFQAPPHAQTKLVRC 78

Query: 72  IAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
             GR+ D+AVDIR+ SPTYG W S E+S  NG+Q+ IP GF HGF+TLE NTE IYK  D
Sbjct: 79  GQGRLLDVAVDIRKGSPTYGQWTSAEMSFENGVQLLIPKGFLHGFVTLEPNTETIYKSDD 138

Query: 132 FYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           +Y+ E D  V + D  I + W + L T++  +S+KD+  P L   DSPF Y+G
Sbjct: 139 YYAPECDGAVRFDDPEIGVDWGIDLKTVI--LSDKDRAAPLLKDFDSPFVYEG 189


>gi|16127863|ref|NP_422427.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter crescentus CB15]
 gi|221236684|ref|YP_002519121.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter crescentus
           NA1000]
 gi|13425385|gb|AAK25595.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter crescentus CB15]
 gi|220965857|gb|ACL97213.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter crescentus
           NA1000]
          Length = 185

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 123/187 (65%), Gaps = 8/187 (4%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M I P+ I     +   +  D RGWFS+T+    L+E G Q  FVQDNH  S   G  RG
Sbjct: 1   MKITPLAIPEVLLITPARHGDERGWFSETFRQSALEEAGFQAAFVQDNHVRSTTRGIQRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LH+Q+PP+AQ KL+RC+ G IFD+AVDIR+ SPT+G WV  E+SA N  Q+ +P GFAHG
Sbjct: 61  LHYQKPPHAQDKLLRCVVGSIFDVAVDIRKGSPTFGHWVGAELSAENRQQLLVPKGFAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQ 174
           ++TL    EV+YKVTD+Y+ + + GV W D +I I WP+ L+ I  + +++D   P L +
Sbjct: 121 YVTLSDACEVLYKVTDYYAPQAEGGVRWSDPAIGIEWPIPLNEI--TANDRDNAAPLLAE 178

Query: 175 IDSPFEY 181
           I++PF Y
Sbjct: 179 IETPFAY 185


>gi|295691457|ref|YP_003595150.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter segnis ATCC
           21756]
 gi|295433360|gb|ADG12532.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter segnis ATCC
           21756]
          Length = 187

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 122/187 (65%), Gaps = 6/187 (3%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M I P+ I     +   +  D RGWFS+T+    L+E G +  FVQDNH  S   G  RG
Sbjct: 1   MKITPLAIPEVLLITPARHGDERGWFSETFRQSALEEAGFKAAFVQDNHVRSTTRGIQRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LH+Q+PP+AQ KL+RC+ G IFD+AVDIR+ SPTYG WV  E+SA N  Q+ +P GFAHG
Sbjct: 61  LHYQKPPHAQDKLLRCVVGAIFDVAVDIRKGSPTYGQWVGAELSAENRQQLLVPKGFAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           ++TL    EV+YKVTD+Y+ + +  V W D ++ I WP+  + + + +++D   P L +I
Sbjct: 121 YVTLTDACEVLYKVTDYYAPQAEGAVRWSDPAVGIDWPIPASEI-TANDRDNAAPLLAEI 179

Query: 176 DSPFEYD 182
           DSPF Y+
Sbjct: 180 DSPFVYE 186


>gi|323135557|ref|ZP_08070640.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylocystis sp. ATCC 49242]
 gi|322398648|gb|EFY01167.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylocystis sp. ATCC 49242]
          Length = 183

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/180 (50%), Positives = 125/180 (69%), Gaps = 3/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  ++++  +KF D RG+FS+TY++   ++ GL   FVQDNHS S D GT+RGLHFQ 
Sbjct: 5   LEIEGLKLVTPKKFGDERGFFSETYNASTWEKAGLHYKFVQDNHSLSRDVGTVRGLHFQT 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + GRI D+AVD+RR+SPT+G  V++E+S  N  Q+ +P GFAHGF+TLE
Sbjct: 65  APFAQDKLVRVVQGRILDVAVDLRRSSPTFGRHVAVELSKENWRQLLVPIGFAHGFVTLE 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSV-SEKDQNLPFLNQIDSPF 179
            +TEV+YKVT+FYS +HD G+AW D  + + WP  D    +V S KDQ  P L  +   F
Sbjct: 125 PDTEVLYKVTNFYSPQHDCGLAWDDPDLGVAWP--DVAKNAVLSAKDQKWPRLRDLPEVF 182


>gi|91976051|ref|YP_568710.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           BisB5]
 gi|91682507|gb|ABE38809.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           BisB5]
          Length = 185

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/180 (51%), Positives = 120/180 (66%), Gaps = 5/180 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+++  + F D+RG F +TY+ K   E G+   FVQDN SFS + GTIRGLHFQ PP
Sbjct: 9   IEAVKVIVPKSFADTRGTFCETYNHKRFVEHGISFEFVQDNQSFSAEAGTIRGLHFQSPP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR + GRI D+AVD+RR+SPT+G WV+ E+SA NG Q+ +P GFAHGF TLE +
Sbjct: 69  AAQDKLVRVLRGRILDVAVDLRRSSPTFGKWVAEELSAENGKQLLVPVGFAHGFCTLEPD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSPFE 180
           T V+YKVT +YS  HD GVAW D  + I WP+   + +L   S+KD   P    +   FE
Sbjct: 129 THVLYKVTSYYSPAHDLGVAWDDPDLAIDWPIRSDEAVL---SDKDLRQPSFRSLAPVFE 185


>gi|294675734|ref|YP_003576349.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter capsulatus SB
           1003]
 gi|294474554|gb|ADE83942.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter capsulatus SB
           1003]
          Length = 187

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 90/178 (50%), Positives = 117/178 (65%), Gaps = 1/178 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++  R+F D RG+FS++YS+K L E G+  VFVQDNHS S   GTIRGLHFQ PP+AQ
Sbjct: 11  VKLITPRRFGDHRGFFSESYSAKALAEHGIDTVFVQDNHSLSMTVGTIRGLHFQNPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G +FD+AVDIR+ SPTYG W   E+S  NG Q+ +P GFAHGF+T    TE+
Sbjct: 71  DKLVRCGKGCLFDVAVDIRKGSPTYGQWFGAELSFENGRQLLVPKGFAHGFVTRAPETEI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYK +D+Y  E +  + W D  I I W + D + P +S KD     +   DS F + G
Sbjct: 131 IYKCSDYYHPETEGALIWNDPDIGIDWGMGD-LEPVLSAKDAVAGRIADFDSAFSWQG 187


>gi|153010045|ref|YP_001371260.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum anthropi ATCC
           49188]
 gi|151561933|gb|ABS15431.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum anthropi ATCC
           49188]
          Length = 183

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 119/172 (69%), Gaps = 1/172 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V  +  RKF D RG+FS+TY++K   E G+   FVQDNHS+S   G +RGLH+Q 
Sbjct: 6   LGLDGVFEVSPRKFGDDRGFFSETYNAKSFAEAGIDLTFVQDNHSYSAAKGVVRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR   G I D+AVDIR++SPT+G WV+LE+SA    QI +P GFAHGFMTL 
Sbjct: 66  LPFAQDKLVRVTRGAILDVAVDIRKSSPTFGKWVALEVSAEKWNQILVPKGFAHGFMTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            NTEVIYKVTD+YS EHD  + + D +I I WP+  + +  +S+KD   P L
Sbjct: 126 ENTEVIYKVTDYYSPEHDRSIRFDDSAIGIDWPIASSGV-QLSDKDSKAPLL 176


>gi|32456001|ref|NP_862003.1| rb128 [Ruegeria sp. PR1b]
 gi|22726353|gb|AAN05149.1| RB128 [Ruegeria sp. PR1b]
          Length = 184

 Score =  187 bits (474), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/176 (52%), Positives = 120/176 (68%), Gaps = 4/176 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+IL  ++F D+RG+FS++++ + +   GL   FVQDNHS S + GTIRGLHFQ PP+AQ
Sbjct: 11  VKILTPQRFGDARGFFSESWNRQRMAAAGLDLDFVQDNHSMSAEVGTIRGLHFQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G +FD+AVDIR+ SPTYG WV +E+SA NG QI +P GF HGF+T    TEV
Sbjct: 71  DKLVRCGQGALFDVAVDIRKGSPTYGEWVGVELSAENGKQILVPKGFLHGFITRAPMTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           IYK TD+Y+ + D GV W    ID  W    T  P +S KD   P L ++DSPF +
Sbjct: 131 IYKCTDYYAPDCDGGVRWDSCGID--WGFDGT--PVLSGKDAVAPILAELDSPFTW 182


>gi|307303497|ref|ZP_07583251.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti
           BL225C]
 gi|306902888|gb|EFN33480.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti
           BL225C]
          Length = 187

 Score =  187 bits (474), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 114/163 (69%), Gaps = 1/163 (0%)

Query: 12  RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRC 71
           R+  D RG+FS+TY+++ L   G+  +FVQDNHS+S   GT+RGLH+Q PP AQAKLVR 
Sbjct: 18  RRLGDERGFFSETYNAETLAAHGVAAIFVQDNHSYSAAAGTLRGLHYQLPPKAQAKLVRV 77

Query: 72  IAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
           + GR+FD+ VDIR+ SPT+  WV+LE+SA    QI +P GFAHG +TLE  TEV+YKVT+
Sbjct: 78  VRGRVFDVVVDIRKGSPTFAKWVALELSAEKWNQILVPVGFAHGLVTLEPETEVLYKVTE 137

Query: 132 FYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YS EH+  + + D  I I WP     L  +S KD+N P L++
Sbjct: 138 HYSAEHERSIRYDDPEIGIGWPAATDRL-QLSAKDRNAPLLHE 179


>gi|300022034|ref|YP_003754645.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523855|gb|ADJ22324.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 183

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/170 (52%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  ++++   +FED RG+FS+TYS K LKE G+   FVQDN S S   GTIRGLHFQ+
Sbjct: 6   LEIPGLKLIVPPRFEDERGFFSETYSEKALKEAGIPAPFVQDNFSLSARKGTIRGLHFQK 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAKLVR   GR+ D+AVDIR +SPTYG  V++E+S  N  Q+YIP GFAHGF TLE
Sbjct: 66  APYAQAKLVRVNRGRVLDVAVDIRSSSPTYGKHVAIELSRENWAQLYIPAGFAHGFCTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            +TEV YK +  Y+ E + G+ W D ++ I WP+  + + +VS+KD  LP
Sbjct: 126 DDTEVAYKTSAPYAPEAEGGILWSDPTLAIAWPVAPSDV-TVSDKDARLP 174


>gi|239831405|ref|ZP_04679734.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum intermedium LMG
           3301]
 gi|239823672|gb|EEQ95240.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum intermedium LMG
           3301]
          Length = 183

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/168 (52%), Positives = 116/168 (69%), Gaps = 1/168 (0%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           +  RKF D RG+FS+TY++K   E G+   FVQDNHS+S   G +RGLH+Q PP+AQ KL
Sbjct: 14  ISPRKFGDDRGFFSETYNAKSFAEAGIDLTFVQDNHSYSAARGVVRGLHYQLPPFAQDKL 73

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           V    G I D+AVDIR+ SPT+G WV+LE+SA    QI +P GFAHGFMTL  +TEVIYK
Sbjct: 74  VHVTRGAILDVAVDIRKGSPTFGKWVALEVSAEKWNQILVPKGFAHGFMTLVEHTEVIYK 133

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           VT++YS EHD  + + D +I I WP+  + +  +S+KDQ  P L   D
Sbjct: 134 VTNYYSPEHDRSIRFDDPAIGIDWPIAPSGV-QLSDKDQKAPMLADAD 180


>gi|254295500|ref|YP_003061522.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hirschia baltica ATCC 49814]
 gi|254044031|gb|ACT60825.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hirschia baltica ATCC 49814]
          Length = 188

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 120/181 (66%), Gaps = 1/181 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V+ +   +F D+RG+FS+TYS +   + GL   +VQDNHS S +   +RGLHFQ 
Sbjct: 6   LGLDGVKEITPARFGDARGFFSETYSEQRFSDAGLPTGWVQDNHSLSAEAFVLRGLHFQT 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G IFD+AVDIR+NSP YG WV + ++A  G QI +P GFAHGF+TL 
Sbjct: 66  DPFAQDKLVRVLKGEIFDVAVDIRKNSPDYGKWVGITLTAEKGNQILVPKGFAHGFLTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            N EV YKVT  Y+ E+D G+ W D +I I WP L+   P +S KD   P L  +D+ FE
Sbjct: 126 PNVEVAYKVTSGYAPENDRGIIWNDPAIGIDWP-LNGHEPQLSGKDAVAPLLADVDNNFE 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|163740057|ref|ZP_02147461.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phaeobacter gallaeciensis
           BS107]
 gi|161386688|gb|EDQ11053.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phaeobacter gallaeciensis
           BS107]
          Length = 184

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 119/182 (65%), Gaps = 4/182 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           ++  V+IL   +F D+RG+F ++++   + E GL   FVQDNHS S + GT+RGLHFQ P
Sbjct: 7   DLPGVKILTPARFGDARGFFCESWNKARMAEAGLDFDFVQDNHSLSMEVGTLRGLHFQAP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVRC  G +FD+AVDIR+ SPTYG W  +E+SA NG Q+ IP GF HGF+T   
Sbjct: 67  PHAQAKLVRCGQGALFDVAVDIRKGSPTYGRWTGVELSAANGRQLLIPAGFLHGFITCSP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            TEV+YK   +Y+ + D GVAW    ID  W    T  P +SEKD   P     DSPF +
Sbjct: 127 GTEVLYKCDAYYAPDCDGGVAWDSCGID--WGFDGT--PVLSEKDARAPRFEDFDSPFVW 182

Query: 182 DG 183
           +G
Sbjct: 183 EG 184


>gi|163743492|ref|ZP_02150870.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phaeobacter gallaeciensis
           2.10]
 gi|161383195|gb|EDQ07586.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phaeobacter gallaeciensis
           2.10]
          Length = 184

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 118/178 (66%), Gaps = 4/178 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+IL   +F D+RG+F ++++   + E GL   FVQDNHS S + GT+RGLHFQ PP+AQ
Sbjct: 11  VKILTPARFGDARGFFCESWNKARMAEAGLDFDFVQDNHSLSMEVGTLRGLHFQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G +FD+AVDIR+ SPTYG W  +E+SA NG Q+ IP GF HGF+T    TEV
Sbjct: 71  AKLVRCGQGALFDVAVDIRKGSPTYGRWTGVELSAANGRQLLIPAGFLHGFITRSPGTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           +YK   +Y+ + D GVAW    ID  W    T  P +SEKD   P    +DSPF ++G
Sbjct: 131 LYKCDAYYAPDCDGGVAWDSCGID--WGFDGT--PVLSEKDAAAPRFEDLDSPFVWEG 184


>gi|115345656|ref|YP_771837.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseobacter denitrificans OCh
           114]
 gi|115292977|gb|ABI93429.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseobacter denitrificans OCh
           114]
          Length = 198

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 121/179 (67%), Gaps = 1/179 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L  ++F D+RG+FS+++S++ +   GL   +VQDNHS S   GT+RGLHFQ PP+AQ
Sbjct: 20  VFVLTPKRFGDARGFFSESWSAREMAAQGLDFTWVQDNHSLSMQTGTVRGLHFQSPPHAQ 79

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G  FD+AVDIRR SPTYG WV  E+S  NG Q+ +PTGF HGF T +  TE+
Sbjct: 80  AKLVRCGRGAFFDVAVDIRRGSPTYGQWVGAELSYENGKQMLVPTGFLHGFATRQPETEI 139

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
           IYK +D+Y+ E D  V +   +I I W L D + P +S+KD     L   DSPF ++G+
Sbjct: 140 IYKCSDYYAPECDGAVRFDCPTIGIDWGLGD-LEPVLSDKDAAAQGLADFDSPFVWEGV 197


>gi|182680403|ref|YP_001834549.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636286|gb|ACB97060.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 191

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++ +KF D+RG+F++TY+++   E G+  VFVQDN S S + GTIRGLHFQ 
Sbjct: 8   LAIPDVLLIRPKKFGDARGYFAETYNARAYCEAGIDCVFVQDNQSLSVEKGTIRGLHFQV 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP  QAKLVR + G I D+AVD+RR SP YG W    ++A  G Q+++P GFAHGF TL 
Sbjct: 68  PPEPQAKLVRVLRGAILDVAVDLRRGSPHYGQWCGATLTAEEGEQLFVPRGFAHGFCTLM 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             TEV YKV  FY+   D+G+ + D  I+I WP LD     +S+KD  LPFL    SPF 
Sbjct: 128 PETEVAYKVDGFYAPGCDAGLRYDDPDINIPWP-LDGKAAMISDKDGKLPFLRDFKSPFT 186

Query: 181 YD 182
           ++
Sbjct: 187 FE 188


>gi|307318652|ref|ZP_07598085.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti AK83]
 gi|306895679|gb|EFN26432.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti AK83]
          Length = 187

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 119/174 (68%), Gaps = 1/174 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V  +  R+  D RG+FS+TY+++ L   G+  +FVQDNHS+S   GT+RGLH+Q 
Sbjct: 7   LGLDGVLEIVPRRLGDERGFFSETYNAETLAAHGVAAIFVQDNHSYSAAAGTLRGLHYQL 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP AQAKLVR + GR+FD+ VDIR+ SPT+  WV+LE+SA    QI +P GFAHG +TLE
Sbjct: 67  PPKAQAKLVRVVRGRVFDVVVDIRKGSPTFAKWVALELSAEKWNQILVPVGFAHGLVTLE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             TEV+YKV++ YS EH+  + + D  I I WP     L  +S KD+N P L++
Sbjct: 127 PETEVLYKVSEHYSAEHERSIRYDDPEIGIGWPAATDRL-QLSAKDRNAPLLHE 179


>gi|310817081|ref|YP_003965045.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ketogulonicigenium vulgare
           Y25]
 gi|308755816|gb|ADO43745.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ketogulonicigenium vulgare
           Y25]
          Length = 183

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 121/178 (67%), Gaps = 4/178 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I+   +  D+RG+FS++++ + + + GL   FVQDNHS S   GT+RGLHFQ PP+AQ
Sbjct: 10  VMIVTPARHGDARGFFSESWNRQRMADAGLVYDFVQDNHSLSMRVGTLRGLHFQSPPHAQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  GR+FD+AVDIR+ SPTYG WV +E+S  NG Q+ IP GF HGF+TLE  TEV
Sbjct: 70  AKLVRCGRGRLFDVAVDIRKGSPTYGKWVGVELSFENGRQLLIPEGFLHGFVTLEPETEV 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           +YK TD+Y+ + D  V W   S  I WPL     P +S+KD     L+  DSPF++ G
Sbjct: 130 VYKCTDYYAPDCDGAVLWD--SCGIEWPLEGE--PLLSDKDLRAVPLSDFDSPFDFKG 183


>gi|86748688|ref|YP_485184.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           HaA2]
 gi|86571716|gb|ABD06273.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           HaA2]
          Length = 185

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 116/178 (65%), Gaps = 1/178 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I+  + F DSRG F +TY+ +   E G+   FVQDN S S   GTIRGLHFQ  P
Sbjct: 9   IEAVKIIVPKGFADSRGVFCETYNHRRFVEYGVSFDFVQDNQSSSARAGTIRGLHFQSHP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR + GRI D+AVD+RR SPTYG WV+ E+SA+NG Q+ +P GFAHGF TLE  
Sbjct: 69  AAQDKLVRVLRGRILDVAVDLRRTSPTYGRWVAEELSADNGKQLLVPVGFAHGFCTLEPE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
           T V+YKVT +Y+  HD GVAW D  + I WP +      +SEKD  LP    + + FE
Sbjct: 129 TLVLYKVTGYYAPAHDLGVAWNDPDLAIDWP-VSADQAVLSEKDMQLPSFRSLPAYFE 185


>gi|89056335|ref|YP_511786.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Jannaschia sp. CCS1]
 gi|88865884|gb|ABD56761.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Jannaschia sp. CCS1]
          Length = 215

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 117/178 (65%), Gaps = 2/178 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++   +F D+RG+F++TYS+  L + G+   FVQDNHS S D GT+RGLHFQ PP+AQ K
Sbjct: 40  VITPPRFGDARGFFAETYSAAKLADHGIMTQFVQDNHSLSEDVGTVRGLHFQGPPHAQDK 99

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVRC  G +FD+ VDIR+ SPT+G W  +E++  NG Q+ +P GFAHGF+T    TE+IY
Sbjct: 100 LVRCGRGCLFDVVVDIRKGSPTFGQWFGIELTFENGKQLLVPAGFAHGFVTRAPGTEIIY 159

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLP 185
           K +DFY+ E +  + W D  I I W L D   P +S KD     L  +DSPF Y+  P
Sbjct: 160 KCSDFYAPETEGAIIWNDPKIGIDWRLEDD--PVLSGKDAVAGTLADLDSPFIYEAKP 215


>gi|150376856|ref|YP_001313452.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium medicae WSM419]
 gi|150031403|gb|ABR63519.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium medicae WSM419]
          Length = 187

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 116/163 (71%), Gaps = 1/163 (0%)

Query: 12  RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRC 71
           RKF D RG+FS+T++++ L   G++  FVQDNHS+S   GT+RGLH+Q PP AQAKLVR 
Sbjct: 18  RKFGDERGFFSETFNAETLAAQGVELSFVQDNHSYSALAGTLRGLHYQLPPKAQAKLVRV 77

Query: 72  IAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
           + GR+FD+ VDIR+ SP++  W+ LE+SA    QI +P GFAHGF+TLE  TEV+YKVT+
Sbjct: 78  VRGRVFDVVVDIRKGSPSFAKWLGLELSAERWNQILVPAGFAHGFVTLEPETEVLYKVTE 137

Query: 132 FYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YS EH+  + + D +I I WP+    L  +S KD+N   LN+
Sbjct: 138 HYSAEHERSIRFDDPAIGIGWPVAADRL-QLSAKDRNAALLNE 179


>gi|169351599|ref|ZP_02868537.1| hypothetical protein CLOSPI_02379 [Clostridium spiroforme DSM 1552]
 gi|169291821|gb|EDS73954.1| hypothetical protein CLOSPI_02379 [Clostridium spiroforme DSM 1552]
          Length = 191

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 1/182 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++T  F D RG+F++TYS    ++LG+   FVQDN SFS   GT+RGLH+Q PP
Sbjct: 8   IPGVLIIETDVFGDHRGYFTETYSKPKYEKLGITVDFVQDNMSFSGQKGTLRGLHWQNPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLV C  G++ D+AVDIR+ SPTYG WVS+E+SA N  Q +IP GFAHGF+TL  +
Sbjct: 68  YAQSKLVSCTKGKVIDVAVDIRKGSPTYGKWVSVELSAENHRQFFIPQGFAHGFLTLTDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E  YKV + Y+ E + G+ + D + ++ W  LLD I P +SEKD   P L + ++ F Y
Sbjct: 128 VEFRYKVDNVYNKESEGGMRYDDPTCNVDWGKLLDGIEPVLSEKDMTGPTLEESNNQFVY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|229160276|ref|ZP_04288275.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus R309803]
 gi|228623237|gb|EEK80064.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus R309803]
          Length = 181

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 125/178 (70%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N   V++L+ R FED RG+F+++Y+ K+L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDVKLLEPRLFEDERGFFTESYNKKVLETLGIAYSFVQDNVSYSTRAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  ++ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFRQWKGYILSADNHRELLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ + IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKELAIPWPVTNPIL---SDKDQVLPLLQEYEDSF 181


>gi|229078512|ref|ZP_04211072.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock4-2]
 gi|228704828|gb|EEL57254.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock4-2]
          Length = 181

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 123/178 (69%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N   V++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDVKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|167755094|ref|ZP_02427221.1| hypothetical protein CLORAM_00598 [Clostridium ramosum DSM 1402]
 gi|237733479|ref|ZP_04563960.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mollicutes bacterium D7]
 gi|167705144|gb|EDS19723.1| hypothetical protein CLORAM_00598 [Clostridium ramosum DSM 1402]
 gi|229383514|gb|EEO33605.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coprobacillus sp. D7]
          Length = 191

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 1/169 (0%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F +TYS+    ELG+ +VFVQDN SF+   GT+RGLHFQ  P AQAKLV C  G 
Sbjct: 21  DHRGYFMETYSTSNFHELGIDNVFVQDNMSFTAKKGTLRGLHFQNDPMAQAKLVSCTKGT 80

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           + D+AVDIR+ SPTY  WV++E+S  N    +IP GFAHGF+TL  N E  YKV + YS 
Sbjct: 81  VIDVAVDIRKGSPTYKQWVAVELSEENKKMFFIPRGFAHGFLTLTDNVEFRYKVDNLYSK 140

Query: 136 EHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           EHD G+ + D S+++ W  LL+ I P +S+KD+N P L++ D  F+++G
Sbjct: 141 EHDRGIRYDDPSVNVDWGGLLNGIEPILSDKDKNGPTLDESDCNFKFEG 189


>gi|16264649|ref|NP_437441.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase protein
           [Sinorhizobium meliloti 1021]
 gi|1890602|emb|CAB01950.1| ExpA8 [Sinorhizobium meliloti]
 gi|15140787|emb|CAC49301.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase protein WgaH
           (formerly ExpA8) [Sinorhizobium meliloti 1021]
          Length = 187

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 1/174 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V  +  R+  D RG+FS+TY+++ L   G+  +FVQDNHS+S   GT+RGLH+Q 
Sbjct: 7   LGLDGVLEIVPRRLGDERGFFSETYNAETLAAHGVAAIFVQDNHSYSAAAGTLRGLHYQL 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP AQAKLVR + GR+FD+ VDIR+ SPT+  WV+LE+SA    QI +P GFAHG +TL+
Sbjct: 67  PPKAQAKLVRVVRGRVFDVVVDIRKGSPTFAKWVALELSAEKWNQILVPVGFAHGLVTLD 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             TEV+YKV++ YS EH+  + + D  I I WP     L  +S KD+N P L++
Sbjct: 127 PETEVLYKVSEHYSAEHERSIRYDDPEIGIGWPAATDRL-QLSAKDRNAPLLHE 179


>gi|328544172|ref|YP_004304281.1| glucose-1-phosphate thymidylyltransferase [polymorphum gilvum
           SL003B-26A1]
 gi|326413915|gb|ADZ70978.1| Glucose-1-phosphate thymidylyltransferase [Polymorphum gilvum
           SL003B-26A1]
          Length = 187

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 126/181 (69%), Gaps = 3/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++ +KF D RG+FS+TY+++   + G+   FVQDNHS+S + GT+RGLH+Q 
Sbjct: 9   LAIPDVLVIEPKKFGDHRGFFSETYNARAFADAGIDLRFVQDNHSYSAEPGTLRGLHYQG 68

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + GRI D+AVD+RR+SPT+G WVS EISA    QI +P GFAH  +TLE
Sbjct: 69  APHAQDKLVRVLRGRILDVAVDLRRSSPTFGKWVSAEISAEAWNQILVPAGFAHAILTLE 128

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL-DTILPSVSEKDQNLPFLNQIDSPF 179
            +TE++YKV+++Y+  HD G+ W D  + I WP+  D ++  +S+KD   PFL  +   F
Sbjct: 129 PHTELLYKVSNYYAPSHDFGIRWNDPELAIDWPISEDKVI--LSDKDAKQPFLKDVADLF 186

Query: 180 E 180
           +
Sbjct: 187 D 187


>gi|218887778|ref|YP_002437099.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758732|gb|ACL09631.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 196

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 113/177 (63%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           L+ R F D RG+F +TY   L   LG+   FVQDNH+ S   G +RGLHFQ PP  QAKL
Sbjct: 14  LEPRVFRDERGFFLETYRRDLFAALGVPAGFVQDNHARSEQPGVLRGLHFQLPPATQAKL 73

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           V    G +FD+AVD+R  SP YG W   E+S  N  ++++P GFAHG+MTLE  +E  YK
Sbjct: 74  VWVTRGSVFDVAVDLRVGSPAYGKWYGCELSERNFARLFVPRGFAHGYMTLEPGSEFQYK 133

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLP 185
           V  +YS E D+G+AW D  + ITWP +   LP +S+KD+ LP L  + SPF ++  P
Sbjct: 134 VDAYYSPERDAGIAWDDPDLGITWPDIAPALPILSDKDRRLPRLRDLQSPFTFEPAP 190


>gi|238927849|ref|ZP_04659609.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas flueggei ATCC
           43531]
 gi|238884294|gb|EEQ47932.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas flueggei ATCC
           43531]
          Length = 186

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 3/169 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D+RGWF +++S K +++ G+   FVQDNHSFS   GT+RGLH+Q  P AQ
Sbjct: 11  VMIIEPQVFGDARGWFMESWSEKKMEDAGIHAAFVQDNHSFSAQKGTLRGLHYQLNPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+R   G IFD+AVDIRRNSPTY  WV  E+SA N  Q++IP GFAHGF+TL  + EV
Sbjct: 71  AKLLRASRGAIFDVAVDIRRNSPTYAQWVGAELSAENYRQLFIPRGFAHGFITLTDDVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YK  + Y+ + D  + W D +I I WPL  T+L   SEKD   P L +
Sbjct: 131 QYKADNLYASDCDGNIRWDDPTIGIAWPLAPTVL---SEKDAAAPLLAE 176


>gi|241203189|ref|YP_002974285.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857079|gb|ACS54746.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 188

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 117/181 (64%), Gaps = 2/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V+ +   +F D RG+FS+ +     +       FVQDN S S   GT+RGLHFQ 
Sbjct: 9   LEIGDVKKVTPARFGDPRGYFSEVFKDFWFRTNVADVSFVQDNESLSAQPGTVRGLHFQS 68

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRC+ G + D+AVDIR  SPTYG WVS E+S  NG Q+++P GFAHGF+TLE
Sbjct: 69  PPFAQGKLVRCLRGALLDVAVDIRHGSPTYGKWVSAELSPENGSQLWVPAGFAHGFVTLE 128

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T + YKVT  YS EHD GV W D  I I WP +D  +  +S+KD   P L+++ + F+
Sbjct: 129 PDTIISYKVTALYSAEHDCGVRWNDAEIGIEWPQMDGYV--LSDKDNKQPRLSELPTYFQ 186

Query: 181 Y 181
           +
Sbjct: 187 F 187


>gi|228906952|ref|ZP_04070819.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           200]
 gi|228852700|gb|EEM97487.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           200]
          Length = 181

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYTFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|295397282|ref|ZP_06807377.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aerococcus viridans ATCC
           11563]
 gi|294974488|gb|EFG50220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aerococcus viridans ATCC
           11563]
          Length = 183

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 120/180 (66%), Gaps = 3/180 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ + F D RGWF++TYS +  KE G+   F+QDNHS S   GT+RGLHFQ  
Sbjct: 7   DIEDVIIIEPKVFGDHRGWFTETYSKEKFKEFGIDIDFIQDNHSLSAQKGTLRGLHFQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRC  G+I D+AVDIR  SPTY  WV++E++  N  Q+ +P GFAHGF+TL  
Sbjct: 67  PKAQTKLVRCTKGKILDVAVDIREGSPTYKKWVAVELTEENKKQLLVPKGFAHGFITLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           N EV YKV ++YS E+D  + + D  I++ W +   IL   SEKD + P L++ D+ F+Y
Sbjct: 127 NVEVQYKVDEYYSPENDRSIRFDDPEINVDWGIDSPIL---SEKDLSAPMLSESDANFKY 183


>gi|158423458|ref|YP_001524750.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Azorhizobium caulinodans ORS
           571]
 gi|158330347|dbj|BAF87832.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Azorhizobium caulinodans ORS
           571]
          Length = 185

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 115/181 (63%), Gaps = 3/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++   +F D RG+FS+TY    L   GL  VF+QDN S S   G IRGLHFQ 
Sbjct: 7   LDIPEVVLITPPRFADPRGYFSETYKKSALDAAGLNHVFIQDNESLSTVPGIIRGLHFQA 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP++QAKLVR ++G I+D+AVDIR+ SPTYG WV   ++A  G QI IP GFAH F TL 
Sbjct: 67  PPFSQAKLVRVVSGAIYDVAVDIRKGSPTYGKWVGATLTAEKGEQILIPHGFAHAFCTLT 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +  V+YKV   YS   + G+ W D  + I WP+ + +   VSEKD+ LP    +DSPF 
Sbjct: 127 PDVRVLYKVDGAYSKASEGGIIWNDPDLAIDWPVSNAL---VSEKDEILPRFKDLDSPFI 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|295100096|emb|CBK89185.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Eubacterium cylindroides
           T2-87]
          Length = 189

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 124/182 (68%), Gaps = 1/182 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I+ T  F D RG+F++TYS     ++G+   FVQDN SFS   GT+RGLH+Q PP
Sbjct: 8   IPGVLIIDTDVFGDHRGYFTETYSKPKYGKMGITVDFVQDNMSFSSQKGTLRGLHWQNPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLV C  G++ D+AVDIR+ SPTYG WVS+E+SA N  Q +IP GFAHGF+TL  +
Sbjct: 68  YAQSKLVSCTKGKVIDVAVDIRKGSPTYGQWVSVELSAENHRQFFIPQGFAHGFLTLTDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E  YKV + Y+ E + G+ + D ++++ W  LL+ I P +SEKD+  P L + D+ F Y
Sbjct: 128 VEFRYKVDNVYNKESEGGMRYDDPTVNVDWGQLLNGIEPVLSEKDKIGPTLEESDNQFVY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|192288554|ref|YP_001989159.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           TIE-1]
 gi|192282303|gb|ACE98683.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris
           TIE-1]
          Length = 185

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/179 (50%), Positives = 120/179 (67%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I+  R F DSRG FS+TY+ +   + G+   FVQDN S S   GT+RGLHFQ  P
Sbjct: 9   IEAVKIITPRAFADSRGTFSETYNRQRFVDHGVALEFVQDNQSISAAVGTVRGLHFQSAP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR   GRI D+AVD+RR+SPTYG WV+ E+SA +G Q+ IP GFAHGF TLE +
Sbjct: 69  FAQDKLVRVAKGRILDVAVDLRRSSPTYGQWVAEELSAEDGKQLLIPIGFAHGFCTLEPD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
           T + YKVT++YS  HD G+AW D  + + WP+  D  +  +S+KD  LP    + + FE
Sbjct: 129 TVLAYKVTNYYSPPHDLGIAWNDPDLAVRWPVTADQAV--LSDKDLKLPPFASLPNYFE 185


>gi|163939116|ref|YP_001644000.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus weihenstephanensis
           KBAB4]
 gi|163861313|gb|ABY42372.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus weihenstephanensis
           KBAB4]
          Length = 181

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 125/179 (69%), Gaps = 3/179 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +N    ++L+ R FED RG+F+++Y+ K+L+ LG+   FVQDN S+S   GTIRGLHFQ+
Sbjct: 6   INFTDAKLLEPRLFEDERGFFTESYNKKMLESLGITHSFVQDNVSYSAHSGTIRGLHFQK 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL 
Sbjct: 66  NPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKKWRGYILSADNHRQLLVPKGFAHGFCTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            +T V+YKV ++YS +HDSG+ W+DK + I WP+ + IL   S+KD+ LP L + +  F
Sbjct: 126 PHTIVMYKVDEYYSADHDSGLLWEDKELSIPWPVTNPIL---SDKDRILPLLQEYEDSF 181


>gi|30019366|ref|NP_830997.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 14579]
 gi|228951698|ref|ZP_04113800.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957591|ref|ZP_04119342.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|229043064|ref|ZP_04190794.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH676]
 gi|229068875|ref|ZP_04202169.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus F65185]
 gi|229126627|ref|ZP_04255639.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-Cer4]
 gi|229143928|ref|ZP_04272345.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST24]
 gi|296501909|ref|YP_003663609.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           BMB171]
 gi|29894909|gb|AAP08198.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 14579]
 gi|228639491|gb|EEK95904.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST24]
 gi|228656567|gb|EEL12393.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-Cer4]
 gi|228714159|gb|EEL66040.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus F65185]
 gi|228726305|gb|EEL77532.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH676]
 gi|228802090|gb|EEM48956.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807983|gb|EEM54500.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|296322961|gb|ADH05889.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           BMB171]
          Length = 181

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|83582768|ref|YP_425074.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodospirillum rubrum ATCC
           11170]
 gi|83578084|gb|ABC24634.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodospirillum rubrum ATCC
           11170]
          Length = 188

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/181 (49%), Positives = 120/181 (66%), Gaps = 1/181 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V+IL+  KF D RG+FS+TY+   L E+G+   F+QDNHSFS   GT+RGLHFQ 
Sbjct: 8   LDIAEVKILRPAKFGDDRGFFSETYNKVALAEVGITLEFIQDNHSFSAKAGTVRGLHFQT 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KL+R + G +FD+AVD+R  SPTYG  VS  ISA    QI IP GFAHG  T+E
Sbjct: 68  PPFAQDKLIRVVRGALFDVAVDLRVGSPTYGQSVSAVISAAAWNQILIPAGFAHGLCTIE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +TEV+YKV+  YS +HD G+ W D ++ I WP+       +S+KD   P L  + + F 
Sbjct: 128 PDTEVLYKVSAPYSPDHDKGLLWNDPALGIEWPVSPGAA-ILSDKDARQPVLADLPAYFT 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|160914760|ref|ZP_02076974.1| hypothetical protein EUBDOL_00767 [Eubacterium dolichum DSM 3991]
 gi|158433300|gb|EDP11589.1| hypothetical protein EUBDOL_00767 [Eubacterium dolichum DSM 3991]
          Length = 191

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 121/180 (67%), Gaps = 1/180 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++T  F D RG+FS+TYS     ELG+   FVQDN SFS   GT+RGLH+Q PP
Sbjct: 8   IPGVLIIETDVFGDHRGYFSETYSKPKYAELGIDVEFVQDNMSFSAQKGTLRGLHWQNPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLV C  G + D+AVDIR+ SPTYG WVS+E++A N  Q +IP GFAHGF+T+  +
Sbjct: 68  YAQSKLVSCTKGAVIDVAVDIRKGSPTYGEWVSVELTAENHRQFFIPQGFAHGFLTISDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E  YKV + Y+ E + G+ + D S+++ W  LL+ I P +SEKD + P L   ++ F Y
Sbjct: 128 VEFRYKVDNVYNKESEGGMRYDDPSVNVDWGSLLNGIEPVLSEKDAHGPTLEDANNQFVY 187


>gi|99077996|ref|YP_611255.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruegeria sp. TM1040]
 gi|99034939|gb|ABF61993.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruegeria sp. TM1040]
          Length = 182

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/180 (50%), Positives = 117/180 (65%), Gaps = 4/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V+IL   +F D+RG+FS++++ K + E GL   FVQDNHS S D GTIRGLHFQ P
Sbjct: 7   KLSGVKILTPARFGDARGFFSESWNRKRMAEHGLDLEFVQDNHSMSADVGTIRGLHFQAP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVRC  G +FD+ VDIR  SPTYG W+ +E+SA NG Q+ +P GF HGF+T   
Sbjct: 67  PHAQDKLVRCGQGVLFDVVVDIRNGSPTYGEWIGVELSAENGRQLLVPKGFLHGFITRAP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            TE+IYK TD+Y+ E D GV W    ID  W       P +SEKD   P    + SPF +
Sbjct: 127 MTEIIYKCTDYYAPECDGGVRWDSCGID--WGFDGQ--PILSEKDAAAPKFADLQSPFVF 182


>gi|288963203|ref|YP_003453482.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Azospirillum sp. B510]
 gi|288915455|dbj|BAI76938.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Azospirillum sp. B510]
          Length = 183

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 120/175 (68%), Gaps = 1/175 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V+I++ +KF D RG+FS+TY+ K  +  GL+  FVQDN S S + GT+RGLHFQ 
Sbjct: 6   LDIPDVKIIRPKKFGDHRGFFSETYNKKTFEAAGLRYDFVQDNQSLSAEVGTVRGLHFQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KL+R + G I D+AVDIR++SPT+G  VS  ISA    QI +P GFAHGF TLE
Sbjct: 66  PPFAQDKLLRVVRGAILDVAVDIRKDSPTFGRHVSAVISAAEWNQILVPIGFAHGFCTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            +TEVIYKVT++YS EHD G+ W D  + I WP +      +S KD+  P   Q+
Sbjct: 126 PDTEVIYKVTNYYSPEHDRGLLWNDPELGIDWP-VSADKAQLSGKDRTHPTFAQL 179


>gi|159046643|ref|YP_001542312.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dinoroseobacter shibae DFL
           12]
 gi|157914402|gb|ABV95831.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dinoroseobacter shibae DFL
           12]
          Length = 184

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 116/178 (65%), Gaps = 4/178 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++L   +F D+RG+FS++YS ++L   G+   FVQDNHS S   GT+RGLHFQ PP+AQ
Sbjct: 11  VKLLTPARFGDARGFFSESYSRRVLAGHGITLDFVQDNHSLSAQVGTVRGLHFQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  GR+FD+AVD+RR SPTYG W   E+S  NG Q+ +P GF HGF+T E +TE+
Sbjct: 71  DKLVRCGRGRLFDVAVDVRRGSPTYGQWFGAELSFENGKQLLVPAGFLHGFVTREPDTEI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           +YK +D+Y+ E D  V W    ID  W       P +S KD     L   DSPF Y+G
Sbjct: 131 VYKCSDYYAPECDGAVHWDSCGID--WGFEGD--PVISAKDAAAVRLADFDSPFVYEG 184


>gi|304438711|ref|ZP_07398649.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368360|gb|EFM22047.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 186

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/179 (49%), Positives = 119/179 (66%), Gaps = 4/179 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D+RGWF +++S+K +++ G+   FVQDNHSFS   GT+RGLH+Q  P AQ
Sbjct: 11  VVIIEPQVFGDARGWFMESWSAKKMEDAGIHVAFVQDNHSFSAQKGTLRGLHYQLNPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+R   G IFD+AVDIRR SPTY  WV +E+SA N  Q++IP GFAHGF+TL  N EV
Sbjct: 71  AKLLRASRGAIFDVAVDIRRGSPTYAQWVGVELSAENYRQLFIPRGFAHGFITLTDNVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS-PFEYDG 183
            YK  + Y+ + D  + W D +I + WPL  T+L   SEKD   P L +     F Y+G
Sbjct: 131 QYKADNLYAPDCDGNIRWDDPAIGVAWPLTPTVL---SEKDAAAPLLAERSELNFVYEG 186


>gi|154253743|ref|YP_001414567.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parvibaculum lavamentivorans
           DS-1]
 gi|154157693|gb|ABS64910.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parvibaculum lavamentivorans
           DS-1]
          Length = 189

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 122/182 (67%), Gaps = 1/182 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+++ + +  D RG+F++TYS +   E+G+   FVQDN S++   GTIRGLHFQRP
Sbjct: 8   SIPEVKVMTSSRAIDGRGFFAETYSRRDFIEIGITADFVQDNESWNSAAGTIRGLHFQRP 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQAKLVR ++G I D+AVDIR  SPTY   V+LE+ A +  QI+IP GFAHGF TL  
Sbjct: 68  DFAQAKLVRVLSGAILDVAVDIRVGSPTYAQHVALELDAADNKQIFIPRGFAHGFCTLAP 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            T V YKV  +YS  H+SG+ W D ++ I WP +D+    +SEKD +LP     +SPF +
Sbjct: 128 ATHVTYKVDAYYSEAHESGLLWNDPNLAIKWP-VDSAAAILSEKDADLPGFAAFESPFMF 186

Query: 182 DG 183
           + 
Sbjct: 187 EA 188


>gi|39933195|ref|NP_945471.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Rhodopseudomonas palustris
           CGA009]
 gi|39652820|emb|CAE25562.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Rhodopseudomonas palustris
           CGA009]
          Length = 185

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/179 (50%), Positives = 119/179 (66%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I+  R F DSRG F +TY+ +   + G+   FVQDN S S   GT+RGLHFQ  P
Sbjct: 9   IEAVKIITPRAFADSRGSFVETYNRQRFVDHGVALEFVQDNQSISAAVGTVRGLHFQSAP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR   GRI D+AVD+RR+SPTYG WV+ E+SA +G Q+ IP GFAHGF TLE +
Sbjct: 69  FAQDKLVRVAKGRILDVAVDLRRSSPTYGQWVAEELSAEDGKQLLIPIGFAHGFCTLEPD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
           T V YKVT++YS  HD G+AW D  + + WP+  D  +  +S+KD  LP    + + FE
Sbjct: 129 TVVAYKVTNYYSPPHDLGIAWNDPDLAVRWPVTADQAV--LSDKDLELPPFASLPNYFE 185


>gi|206968279|ref|ZP_03229235.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1134]
 gi|229177734|ref|ZP_04305108.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 172560W]
 gi|229189408|ref|ZP_04316425.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 10876]
 gi|206737199|gb|EDZ54346.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1134]
 gi|228593999|gb|EEK51801.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 10876]
 gi|228605698|gb|EEK63145.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 172560W]
          Length = 181

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|229056954|ref|ZP_04196349.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH603]
 gi|228720343|gb|EEL71917.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH603]
          Length = 181

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 124/178 (69%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R FED RG+F+++Y+ K+L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFEDERGFFTESYNKKMLESLGITHSFVQDNVSYSAHSGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF T+  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKKWRGYILSADNHRQLLVPKGFAHGFCTMVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSG+ W+DK + I WP+ + IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGLLWEDKELSIPWPVTNPIL---SDKDRILPLLQEYEDSF 181


>gi|217978847|ref|YP_002362994.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylocella silvestris BL2]
 gi|217504223|gb|ACK51632.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylocella silvestris BL2]
          Length = 190

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 115/181 (63%), Gaps = 2/181 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +LK R+F D RG+F +TY+ +   + G+   FVQDN SFS   GTIRGLHFQ PP AQ
Sbjct: 11  VLVLKPRRFADQRGYFVETYNRRTFAKAGVDAQFVQDNQSFSAKAGTIRGLHFQLPPAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVR + G IFD+AVD+R  SPT+G W+   ++A  G Q+ IP GFAH F TLE + EV
Sbjct: 71  AKLVRAVRGAIFDVAVDLRAGSPTFGRWIGETLTAGGGEQLLIPRGFAHAFCTLEDDVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD-GL 184
            YKV DFY+   DSG+ W D  + I WP ++     +S+KD  L       SPF ++ G 
Sbjct: 131 AYKVDDFYAPTCDSGLIWNDPDLKIEWP-VEASAAVLSDKDAKLGRFADFVSPFRFEAGA 189

Query: 185 P 185
           P
Sbjct: 190 P 190


>gi|41205691|gb|AAR99611.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Geobacillus
           stearothermophilus]
          Length = 183

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+ + F D RG+F ++Y+ K+ KELG    FVQDNHS S + GT+RGLH+Q  PYAQ K
Sbjct: 13  LLEPKVFGDHRGFFMESYNDKVFKELGFNYEFVQDNHSLSVEVGTLRGLHYQLEPYAQTK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + G I+D+ VDIR+ SPTYG W    ++  N  Q+ +P GFAHGF T+  NTEVIY
Sbjct: 73  LVRVVRGAIYDVIVDIRKGSPTYGEWQGFILTEWNKRQLLVPKGFAHGFCTIVPNTEVIY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KV ++YS EHD G+ W D  + I WP   T  P +SEKD   P L + ++ F Y
Sbjct: 133 KVDNYYSPEHDRGICWNDPDLKIDWP---THSPILSEKDSKHPRLAEAENNFTY 183


>gi|75759809|ref|ZP_00739886.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218896252|ref|YP_002444663.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus G9842]
 gi|228899900|ref|ZP_04064144.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           4222]
 gi|228964266|ref|ZP_04125385.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|74492709|gb|EAO55848.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218543340|gb|ACK95734.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus G9842]
 gi|228795363|gb|EEM42851.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228859740|gb|EEN04156.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           4222]
          Length = 181

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFIDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|228920040|ref|ZP_04083389.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839496|gb|EEM84788.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 181

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSVKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDRILPLLEEYEDSF 181


>gi|241204008|ref|YP_002975104.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857898|gb|ACS55565.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 192

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 112/167 (67%), Gaps = 1/167 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      F+QDN S S   GT+RGLHFQ PP+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFIQDNESLSAQTGTVRGLHFQIPPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI DI VDIR  SP++G W+S E+S  NG+Q+++P GFAHGF TLE N+ + YKVT  
Sbjct: 78  AGRIMDIVVDIREGSPSFGKWLSQELSPENGMQLWVPAGFAHGFATLEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           YS +HD G+AW D +I I WP  +  +  +S+KD+ LP L  +   F
Sbjct: 138 YSPQHDRGIAWNDPAIGIRWPFYERDM-VLSDKDKTLPRLADLPGHF 183


>gi|295400933|ref|ZP_06810908.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976935|gb|EFG52538.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 183

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (66%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ + F D RG+F ++Y+ K+ KELG    FVQDNHS S + GT+RGLH+Q  PYAQ K
Sbjct: 13  LIEPKVFSDHRGFFMESYNDKVFKELGFNYEFVQDNHSLSVEVGTLRGLHYQLEPYAQTK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR I G ++D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF T+  NTEV+Y
Sbjct: 73  LVRVIRGAVYDVIVDIRKGSPTYGKWQGFILSEWNKRQLLVPKGFAHGFCTIVPNTEVLY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KV ++YS EHD G+ W D  ++I WP   T  P +SEKD   P L + ++ F Y
Sbjct: 133 KVDNYYSPEHDRGICWNDPDLNIDWP---TNSPILSEKDSKHPRLVEAENNFTY 183


>gi|84684395|ref|ZP_01012296.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667374|gb|EAQ13843.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Rhodobacterales bacterium
           HTCC2654]
          Length = 188

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 119/177 (67%), Gaps = 2/177 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V +    ++ D+RG+F++T++ + L   G+   FVQDNHS S   GT+RGLH Q PP
Sbjct: 8   IPGVFVFTPERYGDARGFFAETWNRRQLSAAGVDIDFVQDNHSVSATAGTLRGLHMQTPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVRC  GR+FD+AVDIR +SPT+  WV +E+SA NG Q+ +P GF HGF+T E +
Sbjct: 68  FAQDKLVRCGRGRLFDVAVDIRADSPTFRQWVGVELSAENGKQLLVPRGFLHGFVTREPD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           TEV+YK +++Y+ E D  V + D  I I W L D   P +S+KD   PFL  +D+PF
Sbjct: 128 TEVVYKCSNYYAPECDRAVRFDDPDIGIDWGLTDA--PVLSDKDAKAPFLRDLDNPF 182


>gi|228938436|ref|ZP_04101045.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971315|ref|ZP_04131942.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228977925|ref|ZP_04138306.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis Bt407]
 gi|228781842|gb|EEM30039.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis Bt407]
 gi|228788351|gb|EEM36303.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228821173|gb|EEM67189.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|326938943|gb|AEA14839.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 181

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAKHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|218674078|ref|ZP_03523747.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli GR56]
          Length = 192

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 114/169 (67%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ PP+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQIPPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP++G W+S E+S + G Q++IP GFAHGF T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSFGKWLSQELSPDTGKQLWIPPGFAHGFATIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D +I I WP  +T + S S+KD+ LP L  + + F Y
Sbjct: 138 YSPQHDRGIAWNDPAIGIRWPFDETDMVS-SDKDKTLPRLADLPNHFSY 185


>gi|218233453|ref|YP_002366001.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus B4264]
 gi|229108779|ref|ZP_04238386.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock1-15]
 gi|229149524|ref|ZP_04277756.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus m1550]
 gi|218161410|gb|ACK61402.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus B4264]
 gi|228633870|gb|EEK90467.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus m1550]
 gi|228674670|gb|EEL29907.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock1-15]
          Length = 181

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+FS++Y+ ++L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +S +N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSGDNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ D IL   S+KDQ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPIL---SDKDQILPLLEEYEDSF 181


>gi|229010610|ref|ZP_04167811.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus mycoides DSM 2048]
 gi|229132118|ref|ZP_04260977.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST196]
 gi|229166160|ref|ZP_04293920.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH621]
 gi|228617258|gb|EEK74323.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH621]
 gi|228651338|gb|EEL07314.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST196]
 gi|228750654|gb|EEM00479.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus mycoides DSM 2048]
          Length = 181

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 124/178 (69%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R FED RG+F+++Y+ K+L+ LG+   F+QDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFEDERGFFTESYNKKMLESLGITHSFLQDNVSYSAHSGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKKWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSG+ W+DK + I WP+ + IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGLLWEDKELSIPWPVTNPIL---SDKDRILPLLQEYEDSF 181


>gi|229101900|ref|ZP_04232614.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-28]
 gi|228681483|gb|EEL35646.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-28]
          Length = 181

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLETLGITYSFVQDNVSYSAQAGTIRGLHFQKK 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKGSPTFRQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS EHDSG+ W+DK + I WP+ + IL   S+KD+ LP L + D  F
Sbjct: 127 HTLVMYKVDEYYSAEHDSGLLWEDKELAIPWPVANPIL---SDKDRILPLLQEYDDSF 181


>gi|134300868|ref|YP_001114364.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfotomaculum reducens
           MI-1]
 gi|134053568|gb|ABO51539.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfotomaculum reducens
           MI-1]
          Length = 186

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 115/180 (63%), Gaps = 2/180 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N++ V I++   F D RGWF +TY+     E GL   FVQDN SFS   GT+RG+H+Q  
Sbjct: 7   NLDGVIIVEPAVFGDHRGWFMETYNESKFLEAGLTYKFVQDNQSFSAVKGTLRGIHYQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKLVRCI G IFDIAVDIR+ SP +G W+ ++++A N  Q+ IP GFAHGFMTL  
Sbjct: 67  PKAQAKLVRCIRGAIFDIAVDIRKGSPNFGKWIGIKLTAENKKQLLIPRGFAHGFMTLTE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           + EV YKV + Y+ E D  + W D  I I WP+   I P +S KD+  P L   ++ F Y
Sbjct: 127 DVEVQYKVDELYAPELDRSILWSDPVIGIKWPM--DITPLLSTKDEKAPLLEDAENNFSY 184


>gi|169831838|ref|YP_001717820.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638682|gb|ACA60188.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 190

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 117/181 (64%), Gaps = 4/181 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  + +++ + F D RG+F +TYS +     G++  FVQDNHS S     +RGLH+Q+
Sbjct: 8   LTIPDLVLVEPKVFGDERGFFMETYSYRDFAVFGIRAAFVQDNHSLS-RGPVLRGLHYQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQAKLVRCI G IFD+AVDIRR SPTYG WV +E+SA N  Q+Y+P GFAHGF  L 
Sbjct: 67  KPMAQAKLVRCIHGAIFDVAVDIRRGSPTYGKWVGVELSAENKRQLYLPRGFAHGFCALT 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              EV+YKV ++YS EHD G+ + D  + I WP+     P +S KD  LP L   D+ F 
Sbjct: 127 EVVEVVYKVDNYYSPEHDRGIIYNDPDLGIVWPVAR---PLLSPKDARLPRLKDADNSFV 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|229106721|ref|ZP_04236952.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-28]
 gi|228676719|gb|EEL31334.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-28]
          Length = 185

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 3/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL+ + F D RG+F ++Y+ ++  +LGL   F+QDN S S   GT+RGLHFQ  P AQ
Sbjct: 11  VVILEPKVFGDHRGYFMESYNKEIFNKLGLDYEFIQDNQSLSVPAGTLRGLHFQLNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            K+VRCI G I+D+AVDIR+ SPTYG W+ + +S +N  Q+ +P GFAHGF TL  N+ V
Sbjct: 71  TKIVRCITGAIYDVAVDIRKGSPTYGQWIGVILSEHNKRQLVVPKGFAHGFCTLVPNSTV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV ++YS  HD+G+ W D ++ I WP+ + IL   SEKD   P L + +  F Y
Sbjct: 131 AYKVDEYYSPNHDAGILWNDPALGIDWPVSEPIL---SEKDTKHPLLEEANINFVY 183


>gi|149203262|ref|ZP_01880232.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius sp. TM1035]
 gi|149143095|gb|EDM31134.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius sp. TM1035]
          Length = 189

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 119/181 (65%), Gaps = 1/181 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V IL   +  D+RG+FS++++ + ++E G+   FVQDNHS S   GT+RGLHFQ P
Sbjct: 7   NLPGVVILTPARHGDTRGFFSESWNRRRMQEAGITIDFVQDNHSLSEQVGTVRGLHFQSP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVRC  G ++D+AVDIRR SPTYG WV +++S  NG Q+ IP GF HGF+T   
Sbjct: 67  PHAQAKLVRCGRGALYDVAVDIRRGSPTYGQWVGVDLSFENGRQLLIPEGFLHGFVTRAP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            TE+IYK +D+Y+ E D  V + D  I I W  +D     +S KD   P L +  SPF Y
Sbjct: 127 MTEIIYKCSDYYAPECDGAVRFDDPEIGIDWG-IDPAAAVLSGKDAKAPLLREFVSPFVY 185

Query: 182 D 182
           +
Sbjct: 186 E 186


>gi|167648897|ref|YP_001686560.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter sp. K31]
 gi|167351327|gb|ABZ74062.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caulobacter sp. K31]
          Length = 190

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 118/187 (63%), Gaps = 7/187 (3%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQD-VFVQDNHSFSFDCGTIR 54
           MNI P     V ++   +  DSRGWFS+T+    L+E G +   FVQDNH  S   G +R
Sbjct: 1   MNIQPLSVPDVLLITPARHGDSRGWFSETFRQSALEEAGFEGGAFVQDNHVRSTRRGILR 60

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLHFQ+PP+AQ KL+RC  G IFD+AVDIRR SPT+G WV  E+SA+N  Q+ +P GFAH
Sbjct: 61  GLHFQKPPHAQDKLLRCARGAIFDVAVDIRRGSPTFGQWVGAELSADNARQLLVPKGFAH 120

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            + TL    EV+YKVTD+Y+   +  + W D ++ I WP+    + S +++D     L  
Sbjct: 121 AYCTLTEECEVLYKVTDYYAPAAEGALRWNDPAVGIDWPVPAAEI-STNDRDAAASLLAD 179

Query: 175 IDSPFEY 181
           +D+PF Y
Sbjct: 180 LDTPFTY 186


>gi|328765894|gb|EGF75990.1| hypothetical protein BATDEDRAFT_15110 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 191

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 118/180 (65%), Gaps = 3/180 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V+I++ + F+D+RG+F ++++ +   +LG    F+QDNHS S D   IRGLHFQ  
Sbjct: 7   NLQDVKIIEPKVFKDNRGYFMESFNQQTFADLGNNYYFIQDNHSLSLDKDVIRGLHFQLS 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVR I G I+D+AVDIR+ SPT+G WV + +S  N   + +P GFAHGF TL  
Sbjct: 67  PKAQTKLVRVITGAIYDVAVDIRKGSPTFGSWVGVTLSEENHRMLLVPKGFAHGFCTLTE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           NT V YKV  +YS E+D G+ W D ++ I WP   T  P +SEKD++ P LN  +  F+Y
Sbjct: 127 NTHVQYKVDAYYSSENDKGIRWNDPTLAIDWP---TSKPILSEKDRHQPLLNDAELYFQY 183


>gi|150376943|ref|YP_001313539.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium medicae WSM419]
 gi|150031490|gb|ABR63606.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium medicae WSM419]
          Length = 193

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 1/176 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V  +  ++  D RG+FS+T+S+    ELGL   FVQDNHS+S   G +RGLH+Q 
Sbjct: 8   LGLDEVLEILPQRIGDERGFFSETWSAVRFGELGLALTFVQDNHSYSAAKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+ Q KLVR + G +FD+AVDIRR SPT+  WV +EISA    Q+ IP GFAHGF+TLE
Sbjct: 68  PPFMQNKLVRVVKGAVFDVAVDIRRGSPTFAKWVGVEISARKWNQLLIPKGFAHGFVTLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +TEVIYKVT  YS  HD  + + D  I I WP+  T L  +S+KD+  P L Q +
Sbjct: 128 ADTEVIYKVTSPYSPAHDRSIRFDDPDIAIAWPVPSTEL-QLSDKDRTAPLLRQAE 182


>gi|229175942|ref|ZP_04303439.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus MM3]
 gi|228607536|gb|EEK64861.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus MM3]
          Length = 185

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 117/177 (66%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL+   F D RG+F ++Y+     +LGL+  F+QDN S S   GT+RGLHFQ  P AQ
Sbjct: 11  VLILEPNVFGDHRGYFMESYNKDAFDKLGLKYEFIQDNQSLSVPVGTLRGLHFQLNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            K+VRCI G I+D+AVDIR+ SPTYG W+ + +S +N  Q+ +P GFAHGF TL  N+ V
Sbjct: 71  TKVVRCITGAIYDVAVDIRKGSPTYGQWIGVILSEHNKRQLVVPKGFAHGFCTLVPNSTV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
            YKV ++YS EHDSG+ W D ++ I WP+ + IL   S+KD   P L + +  F Y+
Sbjct: 131 AYKVDEYYSPEHDSGILWNDPALGIDWPVSNPIL---SDKDNKHPMLEEANINFVYE 184


>gi|14521384|ref|NP_126860.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pyrococcus abyssi GE5]
 gi|5458602|emb|CAB50090.1| rfbC dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)
           (dTDP-4-keto-6-deoxyglucose 3,5-epimerase)
           (dTDP-L-rhamnose synthetase) [Pyrococcus abyssi GE5]
          Length = 185

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 4/175 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++K + FED RG+F +TY     ++ G++  FVQDNHS S   G +RGLHFQ+
Sbjct: 8   LSIPDVILIKPKVFEDERGFFMETYKKSDFEKAGIKGEFVQDNHSRS-KYGVLRGLHFQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VRCI G IFD+AVD+R+NSPT+G WV + +S  N  Q+YIP GFAHGF+ L 
Sbjct: 67  EPYAQAKIVRCIRGVIFDVAVDLRKNSPTFGKWVGVILSEFNKWQLYIPRGFAHGFLVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              EV+YKV + Y+ E++ G+ W D  ++I WP+ + IL   SEKD+  P L ++
Sbjct: 127 DVAEVVYKVDNVYAPEYEGGLIWNDPDVNIKWPIDNPIL---SEKDKKWPTLKEL 178


>gi|229171963|ref|ZP_04299528.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus MM3]
 gi|228611306|gb|EEK68563.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus MM3]
          Length = 181

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 124/178 (69%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLEALGVTYSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQAMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W+DK + I WP+ + IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWEDKDLAIPWPVTNPIL---SDKDRILPLLQECEDSF 181


>gi|327188681|gb|EGE55884.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli
           CNPAF512]
          Length = 192

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 112/169 (66%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ  P+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQIAPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP+YG W+S E+S + G Q++IP GFAHGF T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSYGKWLSQELSPDTGKQLWIPAGFAHGFATIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D +I I WP  +  + S S+KD+ LP L  + S F Y
Sbjct: 138 YSPQHDRGIAWNDPAIGIRWPFDERDMVS-SDKDKTLPRLADLPSHFSY 185


>gi|229095802|ref|ZP_04226781.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-29]
 gi|229114753|ref|ZP_04244167.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock1-3]
 gi|228668818|gb|EEL24246.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock1-3]
 gi|228687635|gb|EEL41534.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-29]
          Length = 181

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLETLGVTYSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+RR+SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRRDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|149913028|ref|ZP_01901562.1| hypothetical protein RAZWK3B_03530 [Roseobacter sp. AzwK-3b]
 gi|149813434|gb|EDM73260.1| hypothetical protein RAZWK3B_03530 [Roseobacter sp. AzwK-3b]
          Length = 188

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 2/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L+ R+F D RG+F+++++ K   +LG+   FVQDNHS S   GT+RGLHFQ PP+AQ
Sbjct: 11  VLLLEPRRFGDERGFFAESWNRKTFLDLGIDIDFVQDNHSVSAAVGTVRGLHFQSPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  GR  D+AVD R+ SPTYG WV  E+S  NGLQ+ +P GF HGF+T E +TE+
Sbjct: 71  DKLVRCGRGRFLDVAVDARKGSPTYGQWVGCELSFENGLQLLVPKGFLHGFVTREPDTEI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           IYK +D+Y+ + D  V + D  + I W L     P +SEKD         DSPF Y
Sbjct: 131 IYKCSDYYAPDCDGAVRFDDPDLGIDWGLDGA--PVLSEKDAKAQSFAAFDSPFIY 184


>gi|225863169|ref|YP_002748547.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 03BB102]
 gi|229183519|ref|ZP_04310743.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BGSC 6E1]
 gi|225790174|gb|ACO30391.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 03BB102]
 gi|228599929|gb|EEK57525.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BGSC 6E1]
          Length = 181

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRGLHFQKS 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|86357153|ref|YP_469045.1| dTDP-rhamnose-3,5-epimerase protein [Rhizobium etli CFN 42]
 gi|86281255|gb|ABC90318.1| probable dTDP-rhamnose-3,5-epimerase protein [Rhizobium etli CFN
           42]
          Length = 192

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      F+QDN S S   GT+RGLHFQ PP AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFIQDNESLSAQAGTVRGLHFQIPPLAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP+YG W+S E+S   G Q++IP GFAHGF+T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSYGKWLSQELSPETGKQLWIPAGFAHGFVTIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +H+ G+AW D +I I WP  +  + S S+KD+ LP L  + S F Y
Sbjct: 138 YSPQHERGIAWNDPAIGIGWPFDERDMVS-SDKDKTLPRLADLPSHFSY 185


>gi|15890372|ref|NP_356044.1| dTDP-rhamnose-3,5-epimerase [Agrobacterium tumefaciens str. C58]
 gi|11385991|gb|AAG35059.1|AF314183_1 dTDP-rhamnose-3,5-epimerase [Agrobacterium tumefaciens]
 gi|15158589|gb|AAK88829.1| dTDP-rhamnose-3,5-epimerase [Agrobacterium tumefaciens str. C58]
          Length = 189

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/185 (47%), Positives = 118/185 (63%), Gaps = 7/185 (3%)

Query: 1   MNINPVRILKT---RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLH 57
           + + P+  LK     +F D+RG+FS+ +  +  +E      FVQDN S S   GT+RGLH
Sbjct: 3   LEVFPISGLKKIIPARFGDNRGYFSEVFKREWFRENVANVEFVQDNESLSAQAGTVRGLH 62

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           FQ  P+AQ KLVRCI GR+ D+AVDIR  SPT+G W ++E+S  NG Q+++P GFAHGFM
Sbjct: 63  FQTEPFAQGKLVRCIRGRLLDVAVDIRTGSPTFGQWAAVELSPENGEQLWVPAGFAHGFM 122

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP-LLDTILPSVSEKDQNLPFLNQID 176
           TL  +T + YKVT  YS  HD GV W D +I I WP + D +L   S+KD   P L+++ 
Sbjct: 123 TLVADTVISYKVTAPYSAAHDRGVKWDDPAIGINWPNVADCVL---SDKDAKQPLLSELP 179

Query: 177 SPFEY 181
             F Y
Sbjct: 180 EYFTY 184


>gi|30261324|ref|NP_843701.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. Ames]
 gi|47526494|ref|YP_017843.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184156|ref|YP_027408.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Sterne]
 gi|65318592|ref|ZP_00391551.1| COG1898: dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
           [Bacillus anthracis str. A2012]
 gi|118476792|ref|YP_893943.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis str.
           Al Hakam]
 gi|165872831|ref|ZP_02217457.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0488]
 gi|167636119|ref|ZP_02394424.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0442]
 gi|167641195|ref|ZP_02399449.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0193]
 gi|170686788|ref|ZP_02878008.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0465]
 gi|170708891|ref|ZP_02899325.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0389]
 gi|177654415|ref|ZP_02936312.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0174]
 gi|196036175|ref|ZP_03103574.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus W]
 gi|196037366|ref|ZP_03104677.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus NVH0597-99]
 gi|196044277|ref|ZP_03111513.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 03BB108]
 gi|218902415|ref|YP_002450249.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH820]
 gi|227815935|ref|YP_002815944.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. CDC
           684]
 gi|228913891|ref|ZP_04077516.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228926356|ref|ZP_04089428.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228932594|ref|ZP_04095473.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228944926|ref|ZP_04107287.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229120841|ref|ZP_04250083.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 95/8201]
 gi|229599940|ref|YP_002865745.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0248]
 gi|254682614|ref|ZP_05146475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725412|ref|ZP_05187194.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A1055]
 gi|254734032|ref|ZP_05191746.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Western North America USA6153]
 gi|254740821|ref|ZP_05198510.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Kruger B]
 gi|254753664|ref|ZP_05205700.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Vollum]
 gi|254758761|ref|ZP_05210788.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Australia 94]
 gi|301052860|ref|YP_003791071.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis CI]
 gi|30255178|gb|AAP25187.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. Ames]
 gi|47501642|gb|AAT30318.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178083|gb|AAT53459.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           Sterne]
 gi|118416017|gb|ABK84436.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis str.
           Al Hakam]
 gi|164711408|gb|EDR16959.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0488]
 gi|167510836|gb|EDR86228.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0193]
 gi|167528473|gb|EDR91238.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0442]
 gi|170126207|gb|EDS95100.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0389]
 gi|170669311|gb|EDT20054.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0465]
 gi|172080699|gb|EDT65781.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0174]
 gi|195991150|gb|EDX55119.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus W]
 gi|196024916|gb|EDX63587.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 03BB108]
 gi|196031608|gb|EDX70204.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus NVH0597-99]
 gi|218537776|gb|ACK90174.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH820]
 gi|227007473|gb|ACP17216.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str. CDC
           684]
 gi|228662501|gb|EEL18099.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus 95/8201]
 gi|228814595|gb|EEM60855.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228827063|gb|EEM72818.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228833180|gb|EEM78745.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228845830|gb|EEM90856.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229264348|gb|ACQ45985.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis str.
           A0248]
 gi|300375029|gb|ADK03933.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 181

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|222148114|ref|YP_002549071.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium vitis S4]
 gi|221735102|gb|ACM36065.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium vitis S4]
          Length = 187

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 123/182 (67%), Gaps = 5/182 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V ++  ++F D+RG+F +T+ + L +       FVQDN SFS + GT+RGLHFQ  
Sbjct: 7   KLSGVFLITPKRFGDARGYFMETFRASLFESEVGSFTFVQDNKSFSAEVGTVRGLHFQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLV C AG + D+AVDIR+ SPTYG  V  E++A NG Q+++P GFAHGF TL+ 
Sbjct: 67  PRAQGKLVSCAAGALLDVAVDIRQGSPTYGQMVKAELTAENGCQLWVPPGFAHGFCTLQP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD--TILPSVSEKDQNLPFLNQIDSPF 179
           NT + YKVTD+YS +HD G+ W D ++ I WP+ +   IL   SEKD+  P L+++++ F
Sbjct: 127 NTVISYKVTDYYSPDHDRGLLWNDPALAIDWPVTEDNAIL---SEKDKKQPKLSELETNF 183

Query: 180 EY 181
            Y
Sbjct: 184 VY 185


>gi|190891199|ref|YP_001977741.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium etli CIAT 652]
 gi|190696478|gb|ACE90563.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli CIAT
           652]
          Length = 192

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 111/169 (65%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ  P+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQISPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP+YG W+S E+S   G Q++IP GFAHGF T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSYGEWLSQELSPETGKQLWIPAGFAHGFATIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D +I I WP  +  + S S+KD+ LP L  + S F Y
Sbjct: 138 YSPQHDRGIAWNDPAIGIRWPFDERDMVS-SDKDKTLPRLADLPSHFSY 185


>gi|332715608|ref|YP_004443074.1| dTDP-rhamnose-3,5-epimerase [Agrobacterium sp. H13-3]
 gi|325062293|gb|ADY65983.1| dTDP-rhamnose-3,5-epimerase [Agrobacterium sp. H13-3]
          Length = 189

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 122/182 (67%), Gaps = 4/182 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
            +I+ ++ +   +F DSRG+FS+ +  +  +E  + DV FVQDN S S   GT+RGLHFQ
Sbjct: 6   FSISGLKKITPARFGDSRGYFSEVFKREWFRE-NVSDVEFVQDNESLSAQAGTVRGLHFQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
             P+AQ KLVRC+ GR+ D+AVDIR  SPT+G W ++E+S  NG Q+++P GFAHGFMTL
Sbjct: 65  TQPFAQGKLVRCLRGRLLDVAVDIRTGSPTFGQWTAVELSPENGEQLWVPAGFAHGFMTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
             +T + YKVT  YS  +D GV W D +I I WP +D+ +  +S+KD   P L+++   F
Sbjct: 125 VDDTVISYKVTAPYSAANDRGVKWDDPAIGINWPKMDSCV--LSDKDAKQPSLSELPEYF 182

Query: 180 EY 181
            Y
Sbjct: 183 TY 184


>gi|229090264|ref|ZP_04221509.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-42]
 gi|228693044|gb|EEL46760.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Rock3-42]
          Length = 181

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKRWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|218681703|ref|ZP_03529504.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli CIAT
           894]
          Length = 192

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 113/169 (66%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ  P+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAVAGTVRGLHFQIGPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP++G W+S E+S   G+Q++IP GFAHGF+T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSFGKWLSQELSPETGMQLWIPAGFAHGFVTIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D +I I WP  +  + S S+KD+ LP L  + S F Y
Sbjct: 138 YSPQHDRGIAWNDPAIGIRWPFDEKDMVS-SDKDKTLPRLADLPSHFSY 185


>gi|167461465|ref|ZP_02326554.1| dTDP-dehydrorhamnose 3,5-epimerase [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381926|ref|ZP_08055879.1| heat-inducible transcription repressor-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154127|gb|EFX46450.1| heat-inducible transcription repressor-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 185

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 119/174 (68%), Gaps = 3/174 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V +L+ +   DSRG+F ++++ K+  E GL   +VQDNHS+S + GT+RGLH+Q  P
Sbjct: 8   LESVILLEPKVHGDSRGFFMESFNQKVFTENGLPVAYVQDNHSYSAEAGTLRGLHYQLSP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR  AG I+D+AVDIRR+SP++G W  + +SA+N   + +P G+AHGF TL  +
Sbjct: 68  KAQTKLVRVTAGAIYDVAVDIRRDSPSFGHWTGIILSASNKRMLLVPQGYAHGFCTLVPH 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           TEV+YKV + Y+ E D G+AW D S+ I WP+ D   P +SEKD+ LP L   +
Sbjct: 128 TEVLYKVDELYNPELDRGIAWNDPSLGIDWPVAD---PVLSEKDRTLPLLEDAE 178


>gi|116251392|ref|YP_767230.1| dTDP-rhamnose-3,5-epimerase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256040|emb|CAK07121.1| putative dTDP-rhamnose-3,5-epimerase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 192

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 110/169 (65%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      F+QDN S S   GT+RGLHFQ PP+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFIQDNESLSAQAGTVRGLHFQIPPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP++G W+S E+S   G Q++IP GFAHGF T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIREGSPSFGKWLSQELSPETGKQLWIPAGFAHGFATIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D  I I WP  +  + S S+KD+ LP L  +   F Y
Sbjct: 138 YSPQHDRGIAWNDPMIGIRWPFDERDMVS-SDKDKTLPRLADLPGHFSY 185


>gi|320530257|ref|ZP_08031327.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas artemidis F0399]
 gi|320137690|gb|EFW29602.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas artemidis F0399]
          Length = 184

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 114/169 (67%), Gaps = 3/169 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           VRIL+ + F D+RGWF +++S K +++ G+   FVQDNHSFS + GT+RGLH+Q  P AQ
Sbjct: 11  VRILEPQVFGDARGWFMESWSQKKMEDAGIHVDFVQDNHSFSVERGTLRGLHYQLNPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+R   G +FD+AVDIRR SPTY  W+ +E+SA N  Q++IP GFAHGF+TL  N EV
Sbjct: 71  AKLLRVSRGAVFDVAVDIRRGSPTYAQWIGIELSAENYRQLFIPRGFAHGFITLTDNVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YK  + Y+ + D  + W D +I + WP    +L   SEKD   P L +
Sbjct: 131 QYKADNLYAPDCDGNIRWDDPAIGVAWPFTPVVL---SEKDAIAPSLAE 176


>gi|206901649|ref|YP_002250032.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dictyoglomus thermophilum
           H-6-12]
 gi|206740752|gb|ACI19810.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dictyoglomus thermophilum
           H-6-12]
          Length = 194

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 120/181 (66%), Gaps = 2/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++T+ F D+RG+F +TY+ K  +E+GL+  FVQDN S S   G +RGLHFQ   
Sbjct: 11  IKDLVLIETKIFRDNRGFFMETYNQKEFEEIGLKLNFVQDNLSLS-KKGVLRGLHFQFK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KL+R I G+++D+AVD+R NSPT+G W  +E++  NGL  YIP GFAHGF+TLE +
Sbjct: 69  YPQGKLIRVIKGKVYDVAVDLRINSPTFGKWYGVELTGENGLAFYIPEGFAHGFLTLEDD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           T   YK T+ Y  E+DSG+ W D  IDI WPL       +SEKD+NLP L  I    + +
Sbjct: 129 TYFFYKCTEIYYPEYDSGIIWNDPDIDIKWPLEKVEELIISEKDKNLPKLKDIIDKLKEE 188

Query: 183 G 183
           G
Sbjct: 189 G 189


>gi|218280966|ref|ZP_03487556.1| hypothetical protein EUBIFOR_00114 [Eubacterium biforme DSM 3989]
 gi|218217737|gb|EEC91275.1| hypothetical protein EUBIFOR_00114 [Eubacterium biforme DSM 3989]
          Length = 190

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 122/182 (67%), Gaps = 1/182 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I+ T  F D RG+F++TYS    +++G+   FVQDN SFS   GT+RGLH+Q PP
Sbjct: 8   IPGVLIIDTDVFGDHRGYFTETYSKPKYEKMGITVDFVQDNMSFSAQKGTLRGLHWQNPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLV C  G + D+AVDIR+ SPT+G WVS+E+S  N  Q +IP GFAHGF+TL  +
Sbjct: 68  YAQSKLVSCTKGTVIDVAVDIRKGSPTFGQWVSVELSEENHRQFFIPQGFAHGFLTLTDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E  YKV + Y+ E + G+ + D + ++ W  LL+ I P +SEKDQ  P L + ++ F Y
Sbjct: 128 VEFRYKVDNVYNKESEGGMRYDDPTCNVDWGSLLNGIEPVLSEKDQVGPTLEESNNQFVY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|52144117|ref|YP_082711.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus E33L]
 gi|51977586|gb|AAU19136.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus E33L]
          Length = 181

 Score =  177 bits (448), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L +    F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVIWDDKELAIPWPVTSPIL---SDKDRILPLLQECKDSF 181


>gi|160863322|gb|ABX51888.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Cronobacter sakazakii]
          Length = 180

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 119/175 (68%), Gaps = 4/175 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I+ V I + + F D RG+F ++++ K   E +G +  FVQDNHS S  CG +RGLH+Q 
Sbjct: 7   DISDVLIFEPKVFGDDRGFFFESFNQKTFMEAVGRKVTFVQDNHSKS-ACGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR+NS T+G WV + +SA+N  Q++IP GFAHGF+ L 
Sbjct: 66  DPYAQGKLVRCVVGEVFDVAVDIRKNSTTFGKWVGVNLSADNKRQLWIPEGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              E +YK T++Y+ E D G+ W D+ I I WPL+    P +S KD+N   LN+I
Sbjct: 126 ETAEFVYKTTNYYNPESDRGIIWNDEDISIEWPLVRD--PILSHKDKNQKKLNEI 178


>gi|325295548|ref|YP_004282062.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065996|gb|ADY74003.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/181 (49%), Positives = 116/181 (64%), Gaps = 4/181 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+K + F D RG+F +TY     ++ G+   FVQDNHS S   G +RGLH+Q  
Sbjct: 9   EIPEVVIVKPKVFGDERGFFMETYKKSDFEKAGIDTDFVQDNHSKSVK-GVLRGLHYQLE 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRCI G++FD+AVDIR+ SPT+G WV +E+S+ N L ++IP GFAHGF+TL  
Sbjct: 68  PKAQGKLVRCIKGKVFDVAVDIRKGSPTFGKWVGVELSSENKLMLWIPKGFAHGFLTLSE 127

Query: 122 NTEVIYKVTDF-YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E+IYKV+   YS EHD  + W D  I I WPL     P +SEKD+  PFL   +  F 
Sbjct: 128 EAEIIYKVSGSEYSPEHDRSIRWNDPDIGIEWPLDGE--PILSEKDKLAPFLKDAEINFV 185

Query: 181 Y 181
           Y
Sbjct: 186 Y 186


>gi|251798955|ref|YP_003013686.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. JDR-2]
 gi|247546581|gb|ACT03600.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. JDR-2]
          Length = 182

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 3/178 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++L+   + D RG+F+++Y+ K  +E G+   FVQDNHS S + G +RG+H+Q  P AQ
Sbjct: 8   VKLLEPPVYGDHRGFFTESYNEKTARENGILHAFVQDNHSLSVEAGVLRGMHYQLQPKAQ 67

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR  AG I+D+ VDIRR SPT+G W    +SA N  Q+ +P GFAHGF TL  + EV
Sbjct: 68  TKLVRVTAGAIYDVVVDIRRGSPTFGQWQGFILSAANKRQLLVPQGFAHGFCTLVPSCEV 127

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
            YKV   Y+ EHD G+AW D ++ I WP+   IL   S+KD   P L Q +  F Y+G
Sbjct: 128 QYKVDALYAAEHDRGIAWNDPALGIDWPVTKPIL---SDKDAKHPVLAQAEINFVYEG 182


>gi|122934725|gb|ABM68330.1| RmlC [Geobacillus tepidamans]
          Length = 183

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 114/174 (65%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ + F D RG+F ++Y+ ++ KELG    FVQDNHS S + GT+RGLH+Q  PYAQ K
Sbjct: 13  LIEPKVFGDHRGFFMESYNDQVFKELGFNYEFVQDNHSLSIEVGTLRGLHYQLEPYAQTK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR I G I+D+ VDIR+ S TYG W    +S  N  Q+ +P GFAHGF T+  NTEV+Y
Sbjct: 73  LVRVIRGAIYDVIVDIRKGSLTYGKWQGFILSEGNKRQLLVPKGFAHGFCTIVPNTEVLY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KV ++YS EHD G+ W D  + I WP   T  P +SEKD   P L + ++ F Y
Sbjct: 133 KVDNYYSPEHDRGICWNDPDLKIDWP---THSPILSEKDSKHPRLAEAENNFIY 183


>gi|188997299|ref|YP_001931550.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932366|gb|ACD66996.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 188

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (68%), Gaps = 6/176 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+I+K++ FED+RG+F + Y     ++ GL   FVQDNHS S   G +RGLHFQ  
Sbjct: 9   EIPEVKIVKSKVFEDARGFFLEFYKKSDFEKAGLNVEFVQDNHSKSVK-GVLRGLHFQEK 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q KLVRCI G+IFD+AVDIR +SP +  WV++E+S  N L ++IP GFAHGF+TL  
Sbjct: 68  PYEQGKLVRCIKGKIFDVAVDIRPDSPYFKKWVAVELSEENKLMLWIPPGFAHGFLTLSE 127

Query: 122 NTEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQ 174
             E+IYKV+ + YS  +D G+ W D+ I+I WPL  +D ++  +SEKD+ LP L +
Sbjct: 128 EAEIIYKVSHNEYSPAYDRGIIWNDQDINIKWPLETIDNLI--LSEKDKKLPTLKE 181


>gi|304407809|ref|ZP_07389460.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343292|gb|EFM09135.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus curdlanolyticus
           YK9]
          Length = 185

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 117/181 (64%), Gaps = 3/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V++++T  F D RG+F+++YS +   E G+   FVQDNHS S + G +RG+H+Q  P
Sbjct: 8   LSGVKLIETAVFGDHRGFFTESYSEQRFVENGITHRFVQDNHSLSAEAGVLRGMHYQLNP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR  AG I+D+ VDIRR SPT+G W    +SA+N  Q+ +P GFAHGF TL  N
Sbjct: 68  KAQTKLVRVTAGAIYDVVVDIRRGSPTFGQWQGFILSADNKRQLLVPQGFAHGFCTLVPN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
            EV YKV ++YS E+D G+AW D ++ I WP   T  P +S KD   P L   D  F+Y 
Sbjct: 128 CEVQYKVDEYYSPENDRGIAWNDPALAIDWP---TNYPILSNKDGKHPVLADADINFDYK 184

Query: 183 G 183
           G
Sbjct: 185 G 185


>gi|49477139|ref|YP_035453.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49328695|gb|AAT59341.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
          Length = 181

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F++ Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTEIYNKKVLETLGVTYSFVQDNVSYSTEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|218288134|ref|ZP_03492433.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241493|gb|EED08666.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 181

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 117/178 (65%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V +++   FED+RG+F+++Y+ +    LG+   FVQDNHS+S   GT+RGLH+Q  
Sbjct: 7   DIEGVFLIEPDVFEDARGFFTESYNREKFALLGIDVEFVQDNHSYSAAAGTVRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVR + G I+D+ VDIRR+SPT+G WV + +SA+N  Q+Y+P GFAHGF TL  
Sbjct: 67  PAAQTKLVRVVQGAIYDVVVDIRRHSPTFGRWVGVILSADNRRQLYVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV  +YS EHD G+ W D  + I WP    +L   SEKD   P   + +  F
Sbjct: 127 HTHVMYKVDTYYSPEHDRGIRWDDPELGIPWPTTKAVL---SEKDAKHPGFREAEINF 181


>gi|209548787|ref|YP_002280704.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534543|gb|ACI54478.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 111/169 (65%), Gaps = 1/169 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ PP+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQIPPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP++G W+S E+S   G Q++IP GFAHGF+T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSFGKWLSQELSPETGKQLWIPAGFAHGFVTIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           YS +HD G+AW D  I I WP  +  + S S+KD+ LP L  +   F +
Sbjct: 138 YSPQHDRGIAWNDPMIGIRWPFDERDMVS-SDKDKTLPRLADLPGHFSF 185


>gi|229016571|ref|ZP_04173511.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1273]
 gi|229022778|ref|ZP_04179302.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1272]
 gi|228738590|gb|EEL89062.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1272]
 gi|228744747|gb|EEL94809.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1273]
          Length = 181

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 122/178 (68%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S   GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLETLGITYSFVQDNVSYSAQAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R+ SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKESPTFKQWKGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS +HDSG+ W+DK + I WP+ + IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSAQHDSGLLWEDKELAIPWPVTNPIL---SDKDRILPSLQEYEDSF 181


>gi|116754265|ref|YP_843383.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosaeta thermophila PT]
 gi|116665716|gb|ABK14743.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosaeta thermophila PT]
          Length = 187

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 115/183 (62%), Gaps = 4/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V +++ R F D RG+F ++Y        G+++ FVQDNHS S   G +RGLH+Q 
Sbjct: 8   LDIYDVILIEPRVFRDERGFFMESYKHSEFAAFGIKERFVQDNHSRS-RRGVLRGLHYQN 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP AQ KLVR ++G IFD+AVDIRR SPTYG WV + +S  N   +YIP GFAHGFMTL 
Sbjct: 67  PPRAQGKLVRAVSGEIFDVAVDIRRGSPTYGRWVGVNLSEENMRMLYIPPGFAHGFMTLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              +V+YK TD YS EH++G+ W D  I I WP      P +S +D   P L    + F 
Sbjct: 127 DVADVMYKTTDEYSPEHEAGIIWNDPGIGIEWP---ASRPVLSPRDAKWPGLRDAVNGFV 183

Query: 181 YDG 183
           Y+G
Sbjct: 184 YEG 186


>gi|190569148|ref|ZP_03022046.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis
           Tsiankovskii-I]
 gi|190559731|gb|EDV13718.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus anthracis
           Tsiankovskii-I]
          Length = 181

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVRYKVDEYYSADHDSGVLWNDKELAIPWPVTSPIL---SDKDRILPLLQECEDSF 181


>gi|256831149|ref|YP_003159877.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256580325|gb|ACU91461.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 187

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 114/182 (62%), Gaps = 3/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V +LK + F D RG+F +TYS + L   GL   FVQDN +FS   G +RGLHFQ P
Sbjct: 7   EIPGVLVLKPKVFGDHRGFFCETYSRRQLIAHGLDVDFVQDNEAFSAQAGVLRGLHFQTP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P  QAKLVR   G ++D+ VD+R  SPT+G W    +SA N LQ++IP G AHG+MTLE 
Sbjct: 67  PMTQAKLVRVGRGAVYDVVVDLRTGSPTFGRWQGFTLSAANFLQLFIPAGLAHGYMTLES 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +T+ +YKV  +YS EHD G++  D  + I WP L  I+   S+KD  LP L    SPF  
Sbjct: 127 DTQFLYKVDQYYSPEHDGGISCLDPVLGIDWPDLPPIM---SDKDVRLPCLADFSSPFRM 183

Query: 182 DG 183
           +G
Sbjct: 184 EG 185


>gi|219670474|ref|YP_002460909.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfitobacterium hafniense
           DCB-2]
 gi|219540734|gb|ACL22473.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfitobacterium hafniense
           DCB-2]
          Length = 186

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 114/177 (64%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D RGWF + +S + +KE GL+  FVQDNHSFS   GT+RGLHFQ+   AQ
Sbjct: 11  VYIIEPKVFGDHRGWFMEAWSIQKMKEAGLEYDFVQDNHSFSAQKGTLRGLHFQKGDAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G + D+AVD+R+ SPTY  WV++E+SA N  Q+ IP G AH F+TL  N E 
Sbjct: 71  TKLVRCSRGAVLDVAVDLRKGSPTYKKWVAVELSAENKRQLLIPRGMAHAFLTLTDNVEF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           +YK  +FY  E D  + W D  I++TW + +   P VSEKD + P L   D  F Y+
Sbjct: 131 LYKADNFYCPEADRSIIWNDPEINVTWGIEN---PIVSEKDASAPCLRNSDIDFVYE 184


>gi|324325334|gb|ADY20594.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 181

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDGRGFFTESYNKKVLETLGITYSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFRQWRGYILSADNHRQLLVPKGFAHGFCTLVS 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS  HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSANHDSGVLWSDKELAIPWPVTSPIL---SDKDRILPSLQECEDSF 181


>gi|222148466|ref|YP_002549423.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium vitis S4]
 gi|221735454|gb|ACM36417.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium vitis S4]
          Length = 187

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 123/182 (67%), Gaps = 5/182 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V ++  ++F D+RG+F +T+ + L +       FVQDN SFS + GT+RGLHFQ  
Sbjct: 7   KLSGVFLITPKRFGDARGYFMETFRASLFESEVGPFTFVQDNKSFSAEVGTVRGLHFQLN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLV C AG + D+AVDIR+ SPTYG  V  E++A NG Q+++P GFAHGF TL+ 
Sbjct: 67  PRAQGKLVSCAAGALLDVAVDIRQGSPTYGQMVKAELTAENGCQLWVPPGFAHGFCTLQP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD--TILPSVSEKDQNLPFLNQIDSPF 179
           NT + YKVTD+YS +HD G+ W D ++ I WP+ +   IL   S+KD+  P L+++++ F
Sbjct: 127 NTVISYKVTDYYSPDHDRGLLWNDPALAIDWPVTEDNAIL---SDKDKKQPKLSELETNF 183

Query: 180 EY 181
            Y
Sbjct: 184 VY 185


>gi|218290277|ref|ZP_03494423.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239632|gb|EED06824.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 181

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V +++   FED+RG+F+++Y+ +    LG+   FVQDNHS+S   GT+RGLH+Q  
Sbjct: 7   DIQGVFLIEPDVFEDARGFFTESYNREKFALLGVDVEFVQDNHSYSAAAGTVRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVR + G I+D+ VDIRR SPT+G WV + +SA+N  Q+Y+P GFAHGF TL  
Sbjct: 67  PAAQTKLVRVVQGAIYDVVVDIRRQSPTFGRWVGVILSADNRRQLYVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV  +YS EHD G+ W D  + I WP    +L   SEKD   P   + +  F
Sbjct: 127 HTHVMYKVDAYYSPEHDRGIRWDDPELGIPWPTTKAVL---SEKDAKHPSFREAEINF 181


>gi|261409578|ref|YP_003245819.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. Y412MC10]
 gi|261286041|gb|ACX68012.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. Y412MC10]
          Length = 182

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 119/185 (64%), Gaps = 8/185 (4%)

Query: 1   MNINPVRILKTRKFE-----DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M + P+++L     E     D+RG+F ++Y+  L ++  L   F+QDN S S D G +RG
Sbjct: 1   MKVTPLKLLGASLIEPIVHNDNRGFFMESYNQHLFEQNQLDCSFIQDNQSLSKDAGVVRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LH+Q  P AQ KL+R ++G I+D+ VDIR+NS TYG W+ + +S +N  Q+ +P GFAHG
Sbjct: 61  LHYQLNPKAQTKLIRVLSGAIYDVIVDIRKNSATYGQWIGVILSEHNHRQLLVPKGFAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F TL  +TEV+YKV D+YS EHD G+ W D  + I WP+ + IL   SEKDQN P L   
Sbjct: 121 FCTLVPDTEVLYKVDDYYSPEHDRGILWNDPELAIDWPMSNPIL---SEKDQNHPLLKNA 177

Query: 176 DSPFE 180
           +  FE
Sbjct: 178 ELNFE 182


>gi|42780410|ref|NP_977657.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 10987]
 gi|42736329|gb|AAS40265.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 10987]
          Length = 181

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDGRGFFTESYNKKVLETLGITYSFVQDNVSYSAEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS  HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSANHDSGVLWNDKDLAIPWPVTSPIL---SDKDRILPSLQECEDSF 181


>gi|320352680|ref|YP_004194019.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfobulbus propionicus DSM
           2032]
 gi|320121182|gb|ADW16728.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfobulbus propionicus DSM
           2032]
          Length = 183

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 114/170 (67%), Gaps = 4/170 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           I++ + F D RG+F ++Y+ ++ ++L GL   FVQDNHS S   G +RGLH+Q PP AQ 
Sbjct: 14  IIEPKIFGDERGFFYESYNERVFRQLTGLTVNFVQDNHSRS-TRGVLRGLHYQLPPAAQG 72

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVRC+ G +FD+AVDIR+ SPT+G WV L +SA+N  Q +IP GFAHGF+ L    E +
Sbjct: 73  KLVRCVVGEVFDVAVDIRKQSPTFGRWVGLHLSADNKRQFWIPPGFAHGFVVLSETAEFL 132

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           YK T++Y  ++D G+ W D  + ITWPL DT  P +SEKD   P     +
Sbjct: 133 YKTTEYYQPQYDRGIRWNDPDLAITWPLHDT--PQLSEKDCTAPLFTAAE 180


>gi|260887357|ref|ZP_05898620.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sputigena ATCC
           35185]
 gi|330838667|ref|YP_004413247.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sputigena ATCC
           35185]
 gi|260862895|gb|EEX77395.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sputigena ATCC
           35185]
 gi|329746431|gb|AEB99787.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sputigena ATCC
           35185]
          Length = 190

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 119/186 (63%), Gaps = 8/186 (4%)

Query: 1   MNINPVR-----ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           MN+   R     IL+ + F D+RGWF +++S K ++E GL   FVQDN SFS + GT+RG
Sbjct: 1   MNVTETRLKGVFILEPQVFGDARGWFMESWSKKKMEEAGLFYDFVQDNQSFSAEKGTLRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LH+Q+ P AQAKL+RC  G I D+AVDIR+ SP Y  WVS+ +SA N  Q+ IP GFAHG
Sbjct: 61  LHYQKNPMAQAKLLRCTRGEILDVAVDIRKGSPQYAKWVSVRLSAENKRQLMIPRGFAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+TL  + EV YK  ++Y+ E D  + W D +I + W +  T+L   S KD+  P L + 
Sbjct: 121 FITLTDDVEVQYKADNYYAPECDGNILWSDPAIGVDWEIAPTVL---SAKDEAAPTLAER 177

Query: 176 DSPFEY 181
           +S   +
Sbjct: 178 ESQLNF 183


>gi|47568422|ref|ZP_00239123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus G9241]
 gi|206977669|ref|ZP_03238561.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus H3081.97]
 gi|217958796|ref|YP_002337344.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH187]
 gi|222094943|ref|YP_002529003.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Q1]
 gi|228984390|ref|ZP_04144569.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229138008|ref|ZP_04266606.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST26]
 gi|229195516|ref|ZP_04322284.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus m1293]
 gi|47554970|gb|EAL13320.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus G9241]
 gi|206744097|gb|EDZ55512.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus H3081.97]
 gi|217065626|gb|ACJ79876.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH187]
 gi|221239001|gb|ACM11711.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus Q1]
 gi|228588056|gb|EEK46106.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus m1293]
 gi|228645353|gb|EEL01587.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus BDRD-ST26]
 gi|228775359|gb|EEM23746.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 181

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLETLGVTYSFVQDNVSYSTEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS  HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 127 HTIVMYKVDEYYSANHDSGVLWNDKDLAIPWPVTSPIL---SDKDRILPSLQECEDSF 181


>gi|313673142|ref|YP_004051253.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939898|gb|ADR19090.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 185

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 2/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ + ++K + F D RG+F +TY     K LG+ D FVQDNHS S   GTIRGLHFQ+ P
Sbjct: 10  IDGLLVIKPQMFRDDRGFFMETYKESDFKSLGISDRFVQDNHSKS-KKGTIRGLHFQKQP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR   G  +D+AVDIR+ SPT+G W +LE+S  N L ++IP GFAHGF+ LE +
Sbjct: 69  HAQGKLVRVTRGAAWDVAVDIRKGSPTFGKWYALELSGENNLMLWIPAGFAHGFLALEDD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           TE++YK T  Y    D G+ W D  I + WP L  I   +S+KD  LP+L  I+ 
Sbjct: 129 TELLYKCTAEYHAPSDGGIRWNDPIIGVKWPEL-GIPYIISQKDMQLPYLKDIEG 182


>gi|114571007|ref|YP_757687.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Maricaulis maris MCS10]
 gi|114341469|gb|ABI66749.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Maricaulis maris MCS10]
          Length = 188

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 114/183 (62%), Gaps = 5/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++  R+FED RG+FS+TY+  +  E G+   FVQDNHS S   GT+RGLH+Q 
Sbjct: 6   LDIPDVIVVTPRRFEDDRGYFSETYNETVFAEAGIGARFVQDNHSCSLQAGTVRGLHYQS 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR  +G I D+ VD+RR SP +G  V  EISA  G QI++P GF HGF+TL+
Sbjct: 66  LPHAQGKLVRVTSGAIIDVVVDVRRGSPHFGQHVKAEISAEKGSQIWVPAGFLHGFITLQ 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSP 178
            NT V YKVTDFY    D  V W D ++ I W +   D IL   S+KD       +  SP
Sbjct: 126 PNTHVTYKVTDFYDAGCDGSVLWSDPALGIDWGIGQSDAIL---SDKDAEAQSWQEFSSP 182

Query: 179 FEY 181
           F Y
Sbjct: 183 FLY 185


>gi|242400018|ref|YP_002995443.1| RfbC dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus sibiricus
           MM 739]
 gi|242266412|gb|ACS91094.1| RfbC dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus sibiricus
           MM 739]
          Length = 185

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++K + FED RG+F +TY     ++ G++  F+QDNHS S   G +RGLHFQR
Sbjct: 8   LEIPDVILIKPKVFEDERGFFMETYKKPDFEKAGIKGDFIQDNHSKS-KYGVLRGLHFQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VRCI G I+D+AVD+R++SPT+G WV + +S +N  Q+YIP GFAHGF+ L 
Sbjct: 67  EPYAQAKIVRCIRGVIYDVAVDLRKDSPTFGKWVGVILSEHNKWQLYIPKGFAHGFLVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              EV+YKV + Y+  ++ G+ W D  I I WP+     P+VSEKD   P L +
Sbjct: 127 DVAEVVYKVDNVYAPNYEGGIIWNDPDIGIDWPVDK---PTVSEKDMKWPTLRE 177


>gi|154151293|ref|YP_001404911.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Methanoregula
           boonei 6A8]
 gi|153999845|gb|ABS56268.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanoregula boonei 6A8]
          Length = 191

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 120/184 (65%), Gaps = 4/184 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +N + I++   F+D RG+F +TY+ +   E+G+ D FVQDN S S   G +RGLH+Q  
Sbjct: 10  KLNDITIIRPTVFKDDRGFFLETYNREEFAEVGITDEFVQDNVSHSAK-GVVRGLHYQSK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVR + G+IFD+ VDIR  SPTYG  + +E+ A +   +++P GFAHGFM L+ 
Sbjct: 69  -NAQGKLVRVLRGKIFDVVVDIRNGSPTYGHHLGIELDAQDAGMLFVPVGFAHGFMALKD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
            TEV+YKVTDFYS ++D+G+ W D  + I WP+   +   P VS KD  LPFL  I SPF
Sbjct: 128 ATEVMYKVTDFYSPQYDAGIRWDDPDLRIPWPMKAQEISRPVVSPKDAVLPFLRDIISPF 187

Query: 180 EYDG 183
            Y G
Sbjct: 188 NYAG 191


>gi|254168004|ref|ZP_04874852.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
 gi|289595933|ref|YP_003482629.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
 gi|197623047|gb|EDY35614.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
 gi|289533720|gb|ADD08067.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
          Length = 191

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 117/172 (68%), Gaps = 4/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + FED RG+F +TY     ++ G++  F+QDNHS S   G +RGLHFQR PYAQ
Sbjct: 18  VIIIRPKVFEDERGFFMETYKKDDFEKNGIKGEFLQDNHSHS-KYGVLRGLHFQREPYAQ 76

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AK+VRCI G IFD+AVD+R +SPT+G +V + +S  N   ++IP GFAHGF+ L    +V
Sbjct: 77  AKIVRCIKGEIFDVAVDLRESSPTFGKYVGVVLSEKNKKMLFIPRGFAHGFLVLSEEADV 136

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           +YKV + Y+ E++ G+ W D  ++I WP    I P +SEKD+N P L ++ +
Sbjct: 137 VYKVDNIYAPEYEGGLIWNDPDVNIEWP---EIKPILSEKDKNWPTLKELKN 185


>gi|16357460|gb|AAL18012.1| dTDP-dehydrorhamnose 3,5-epimerase [Aneurinibacillus
           thermoaerophilus]
          Length = 182

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (66%), Gaps = 3/175 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L+ + F D RG+F ++Y+  +L+ LG+   FVQDN S S + G +RGLH+Q  P AQ
Sbjct: 11  VVLLEPKVFGDGRGFFMESYNKAVLEVLGIHIDFVQDNQSLSREAGVLRGLHYQLNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G I+D+ VDIR+NSPT+G W +  +S  N  Q+ +P GFAHGF TL  NT+V
Sbjct: 71  TKLVRVLTGAIYDVVVDIRKNSPTFGQWEAFILSEENKRQLLVPKGFAHGFCTLVPNTQV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            YKV ++YS EHD G+AW D +++I WP  + IL   SEKD+  P L + +  FE
Sbjct: 131 FYKVDEYYSPEHDRGIAWDDAALNIPWPTSEPIL---SEKDKCHPVLAEAEINFE 182


>gi|33637042|gb|AAQ23680.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Geobacillus
           stearothermophilus]
          Length = 187

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 114/177 (64%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++ + F D RG+F ++Y+ KL  E GL   F+QDNHS S   GTIRGLH+Q  P AQ
Sbjct: 11  VWLIEPKVFGDHRGFFMESYNKKLFAEYGLDFDFIQDNHSLSRQAGTIRGLHYQLNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G I+D+ VDIR+ SPT+G W    +SA+N  Q+ +P GFAHGF TL  NTEV
Sbjct: 71  TKLVRVTRGAIYDVVVDIRKGSPTFGKWQGFILSADNKRQLLVPKGFAHGFCTLVENTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
            YKV ++YS EHD G+ W D ++ I WP   T  P +S+KD   P L   +  FE++
Sbjct: 131 QYKVDEYYSPEHDRGILWNDPALGIDWP---TANPILSDKDTKHPLLADAEINFEWE 184


>gi|218531920|ref|YP_002422736.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           chloromethanicum CM4]
 gi|218524223|gb|ACK84808.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           chloromethanicum CM4]
          Length = 184

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 113/180 (62%), Gaps = 5/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++  D RGWFS+ Y + LL E G+ + FVQDN SFS   GTIRGLHFQ  
Sbjct: 8   EIPAVKRVIPKRHGDDRGWFSEVYRADLLAEHGIANAFVQDNQSFSAPAGTIRGLHFQVA 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKLVR +AG I D+AVD+R +SPTYG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 68  PNAQAKLVRVLAGAILDVAVDLRSDSPTYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 128 DTMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 184


>gi|218530621|ref|YP_002421437.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           chloromethanicum CM4]
 gi|218522924|gb|ACK83509.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           chloromethanicum CM4]
          Length = 183

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 113/180 (62%), Gaps = 5/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++  D RGWFS+ Y + LL E G+ + FVQDN SFS   GTIRGLHFQ  
Sbjct: 7   EIPAVKRVIPKRHGDDRGWFSEVYRADLLAEHGIANAFVQDNQSFSAPAGTIRGLHFQVA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKLVR +AG I D+AVD+R +SPTYG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 67  PNAQAKLVRVLAGAILDVAVDLRSDSPTYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 127 DTMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 183


>gi|187731823|ref|YP_001879841.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella boydii CDC 3083-94]
 gi|187428815|gb|ACD08089.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella boydii CDC 3083-94]
          Length = 185

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 117/168 (69%), Gaps = 5/168 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S + G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAIGRKVEFVQDNHSKS-NKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +S+ N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSSENMRQLWIPEGFAHGFLVLSDTAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
            +YK T +Y  E DSG+ W DK+I I WPL +   P +SEKD N LPF
Sbjct: 130 FLYKTTKYYHPESDSGIIWNDKNIGICWPLREK--PIISEKDSNLLPF 175


>gi|260460165|ref|ZP_05808417.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033810|gb|EEW35069.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mesorhizobium opportunistum
           WSM2075]
          Length = 184

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I+ V  +  ++  D+RG+F +TY+++   + G+  VFVQDNHS+S   G +RGLH+Q 
Sbjct: 7   LGIDGVLEIVPKRHGDARGFFVETYNAERFAQAGIDLVFVQDNHSYSAAAGVLRGLHYQL 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R I G + D+AVDIRR S T+G WV+LE+SA  G QI +P GFAHGF+TL 
Sbjct: 67  APRAQDKLLRVIRGSVLDVAVDIRRGSKTFGKWVALEVSAKKGNQILVPKGFAHGFVTLV 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +TEV+YKVTD YS EHD  + + D +I I WP L +    +S+KD   P L
Sbjct: 127 PDTEVLYKVTDTYSPEHDRSICFDDPAIGIEWPSLASGF-QLSDKDLKAPLL 177


>gi|255263144|ref|ZP_05342486.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thalassiobium sp. R2A62]
 gi|255105479|gb|EET48153.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thalassiobium sp. R2A62]
          Length = 190

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 114/178 (64%), Gaps = 1/178 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL  ++  D RG+FS+ ++S+   E G++  +VQDNHSF+ + G IRG+H QRPP+ Q
Sbjct: 11  VLILTPKRHGDDRGFFSECWNSRTYAENGIEINYVQDNHSFNNEVGVIRGMHAQRPPHPQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC  G +FD+ VD+R  SPTYG W+  E+S  NG Q+ +P G  HGFMTL   TE+
Sbjct: 71  IKLVRCGHGLLFDVVVDVRAGSPTYGQWIGCELSFENGRQLLVPAGCLHGFMTLLPGTEI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYK +D+Y+ E +  + + D  I I WPL     P +S+KD+  P L    SPF Y G
Sbjct: 131 IYKCSDYYAPETECSLRFDDPDIGIKWPLGGGT-PILSDKDKAAPLLKDFKSPFTYPG 187


>gi|62955960|gb|AAY23336.1| RmlC [Shigella boydii]
          Length = 185

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 117/168 (69%), Gaps = 5/168 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S + G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-NKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +S+ N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSSENMRQLWIPEGFAHGFLVLSDTAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
            +YK T +Y  E DSG+ W DK+I I WPL +   P +SEKD N LPF
Sbjct: 130 FLYKTTKYYHPESDSGIIWNDKNIGICWPLREK--PIISEKDSNLLPF 175


>gi|14590334|ref|NP_142400.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pyrococcus horikoshii OT3]
 gi|3256819|dbj|BAA29502.1| 188aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
           [Pyrococcus horikoshii OT3]
          Length = 188

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 118/175 (67%), Gaps = 4/175 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++K + FED RG+F +TY     ++ G++  FVQDNHS S   G +RGLHFQR
Sbjct: 11  LEIPDVVLIKPKVFEDERGFFMETYKKSDFEKAGIKGEFVQDNHSKS-KYGVLRGLHFQR 69

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             YAQAK+VRCI G I+D+AVD+RRNSPT+G +V + +S  N  Q+YIP GFAHGF+ L 
Sbjct: 70  GSYAQAKIVRCIRGVIYDVAVDLRRNSPTFGKYVGVILSEYNKYQLYIPRGFAHGFVVLS 129

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              EV+YKV + Y+ +++ G+ W D  + I WP+ D IL   SEKD+  P L ++
Sbjct: 130 DVAEVVYKVDNVYAPDYEGGLIWNDPDVGIKWPIEDPIL---SEKDKKWPTLREL 181


>gi|212224999|ref|YP_002308235.1| hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus
           onnurineus NA1]
 gi|212009956|gb|ACJ17338.1| hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus
           onnurineus NA1]
          Length = 185

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++K + FED RG+F +TY     ++ G++  FVQDNHS S   G +RGLHFQR
Sbjct: 8   LEIPDVILIKPKVFEDERGFFMETYKKSDFEKAGIKGEFVQDNHSKS-RYGVLRGLHFQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VR + G I+D+AVD+R+NSPT+G WV + +S +N  Q+YIP GFAHGF+ L 
Sbjct: 67  QPYAQAKIVRAVRGVIYDVAVDLRKNSPTFGRWVGVILSEHNKYQLYIPRGFAHGFLVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              EV+YKV + Y+ +++ G+ W D  I I WP+     P VSEKD+  P L +
Sbjct: 127 DVAEVVYKVDNVYAPDYEGGIIWNDPDIGIDWPIDG---PIVSEKDRKWPTLKE 177


>gi|229154885|ref|ZP_04282999.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 4342]
 gi|228628443|gb|EEK85156.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus ATCC 4342]
          Length = 181

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 120/178 (67%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N    ++L+ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ 
Sbjct: 7   NFTDAKLLEPRLFGDERGFFTESYNKKVLETLGVTYSFVQDNVSYSTEAGTIRGLHFQKN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KL++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V+YKV ++YS  HDSGV W DK + I WP+   IL   S+KD+ LP L   +  F
Sbjct: 127 HTIVMYKVDEYYSANHDSGVLWNDKDLAIPWPVTSPIL---SDKDRILPSLQDCEDSF 181


>gi|296531723|ref|ZP_06894552.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseomonas cervicalis ATCC
           49957]
 gi|296267955|gb|EFH13753.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseomonas cervicalis ATCC
           49957]
          Length = 208

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++ TR+F D+RG+FS+++S++ L   GL   FVQDN S S   GT+RGLHFQ  P  QAK
Sbjct: 38  MIGTRRFGDARGYFSESWSARDLAACGLVAEFVQDNFSTSAQVGTLRGLHFQIAPEPQAK 97

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + GR+ D+AVD+RR SPTYG  V++E++A  G Q+++P GFAHGF TLE +  V Y
Sbjct: 98  LVRVLRGRVLDVAVDLRRASPTYGQHVAVELTAEAGNQLFVPEGFAHGFCTLEPDCAVAY 157

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           KVT +Y+   D GVAW D  + I WPL     P +S+KD   P L ++ + F
Sbjct: 158 KVTGYYAPACDKGVAWDDPDLAIAWPLPPGG-PVLSDKDARQPKLAELPAYF 208


>gi|254168131|ref|ZP_04874978.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
 gi|197622897|gb|EDY35465.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aciduliprofundum boonei T469]
          Length = 191

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 117/176 (66%), Gaps = 4/176 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+  + FED RG+F +TY     ++ G++  F+QDNHS+S   G +RGLHFQR 
Sbjct: 14  EIRDVIIITPKVFEDERGFFMETYKKDDFEKNGIKGEFLQDNHSYS-KYGVLRGLHFQRE 72

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQAK+VRCI G IFD+AVD+R +SPT+G +V + +S  N   ++IP GFAHGF+ L  
Sbjct: 73  PYAQAKIVRCIKGEIFDVAVDLRESSPTFGKYVGVVLSEENKKMLFIPRGFAHGFLVLGE 132

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             +V+YKV   Y+ E++ G+ W D  ++I WP    I P +SEKD+N P L ++ +
Sbjct: 133 EADVMYKVDSVYAPEYEGGLIWSDPDVNIKWP---EIKPILSEKDKNWPTLRELKN 185


>gi|9957823|gb|AAG09505.1|AF279616_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 177

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 4/168 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFSDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQVEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCIAG +FD+AVDIR++S T+G WV + IS+ N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCIAGEVFDVAVDIRKDSETFGKWVGVNISSENKRQLWIPEGFAHGFLVLGEEAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +YK ++FY+ + D GVAW D  I I WPL++   P +S KD   PFL
Sbjct: 130 FVYKTSNFYNPDSDRGVAWNDPDIGINWPLINN--PLLSNKDSKQPFL 175


>gi|229028989|ref|ZP_04185088.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1271]
 gi|228732269|gb|EEL83152.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus AH1271]
          Length = 168

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 119/171 (69%), Gaps = 3/171 (1%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           ++ R F D RG+F+++Y+ K+L+ LG+   FVQDN S+S + GTIRGLHFQ+ P AQ KL
Sbjct: 1   MEPRLFGDERGFFTESYNKKVLETLGVTYSFVQDNVSYSAEAGTIRGLHFQKNPKAQTKL 60

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           ++ + G I+D+ VD+R++SPT+  W    +SA+N  Q+ +P GFAHGF TL  +T V+YK
Sbjct: 61  IQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHGFCTLVAHTIVMYK 120

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           V ++YS +HDSGV W DK + I WP+   IL   S+KD+ LP L + +  F
Sbjct: 121 VDEYYSADHDSGVIWDDKELAIPWPVTSPIL---SDKDRILPLLQEYEDSF 168


>gi|170748798|ref|YP_001755058.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655320|gb|ACB24375.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 183

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 114/178 (64%), Gaps = 1/178 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++F D+RGWFS+T+ +  L   G+   F+QDN SFS   GT+RGLHFQ  
Sbjct: 7   EIPDVKRIVLKRFGDARGWFSETFRADTLARAGIATPFIQDNQSFSAPQGTVRGLHFQIA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKL+R + G I D+AVDIR +SPTYG +V++ + A  G Q+YIP GFAHGF TL  
Sbjct: 67  PRAQAKLIRVLQGAILDVAVDIRSDSPTYGKYVAVTLDAEKGEQLYIPHGFAHGFCTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +  V YKV D+YS EHD  + W D +I I WP+       +S+KD+  P L  + S F
Sbjct: 127 DVMVTYKVDDYYSPEHDRALFWNDPAIGIPWPVSGEAA-ILSDKDRRAPKLADLGSVF 183


>gi|209967309|ref|YP_002300224.1| dTDP-4-dehydrorhamnose 3,5-epimerase, putative [Rhodospirillum
           centenum SW]
 gi|209960775|gb|ACJ01412.1| dTDP-4-dehydrorhamnose 3,5-epimerase, putative [Rhodospirillum
           centenum SW]
          Length = 191

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 1/181 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V ++  R+F D RG+F + Y  +  +  G+   F+QDN S S    T+RGLHFQRPP
Sbjct: 8   IAGVLLITPRRFFDDRGYFVELYQEERYRAAGVDARFMQDNRSLSRPVYTVRGLHFQRPP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLV+ + G I D+AVDIR  SPT+G  V++ +SA  G Q+Y+P GFAHGF TLE +
Sbjct: 68  FAQAKLVQVLRGSIVDVAVDIRHGSPTFGRHVAVTLSAEAGNQLYVPAGFAHGFCTLEPD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           TEV YKV+  YS EHD G+ W D ++ I WP        VS+KD+ LP L  +   F Y+
Sbjct: 128 TEVHYKVSAPYSREHDGGIHWADPALGIDWP-AGPDRAVVSDKDRVLPRLADLGPLFHYE 186

Query: 183 G 183
           G
Sbjct: 187 G 187


>gi|325169025|ref|YP_004285771.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
 gi|325052900|dbj|BAJ83234.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
          Length = 184

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (65%), Gaps = 3/175 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++   +F DSRGWFS+T++   L  LG  + FVQDNHS S   GTIRGLH Q  P+AQ
Sbjct: 10  VKLITPPRFADSRGWFSETWNQAKLAALGFTETFVQDNHSCSTRPGTIRGLHCQIAPFAQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRCI G I+D+AVDIR  SP +G + + E+SA NG Q++IP GF HGF TLE +TEV
Sbjct: 70  GKLVRCIRGAIWDVAVDIRHGSPGFGRFAAAELSAANGAQLWIPPGFLHGFCTLEPDTEV 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLL-DTILPSVSEKDQNLPFLNQIDSPF 179
           +YKVT  Y    + GV W D  + + WP+  D  L  +S+KD  LP L + +  F
Sbjct: 130 VYKVTAPYDKASERGVIWNDPDLALPWPVPGDGAL--LSDKDNLLPRLAEAEPWF 182


>gi|292669522|ref|ZP_06602948.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas noxia ATCC 43541]
 gi|292648731|gb|EFF66703.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas noxia ATCC 43541]
          Length = 186

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 112/169 (66%), Gaps = 3/169 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL+ + F D+RGWF +++S K ++  G+   FVQDNHSFS   GT+RGLH+Q  P AQ
Sbjct: 11  VFILEPQVFGDARGWFMESWSQKKMENAGINVNFVQDNHSFSAQRGTLRGLHYQLNPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+R   G IFD+AVDIRR SPTY  WV +E+SA N  Q++IP GFAHGF+TL  N EV
Sbjct: 71  AKLLRVSRGAIFDVAVDIRRGSPTYAKWVGIELSAENYRQLFIPRGFAHGFITLTDNVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YK  +FY+   D  + W D  I I WP+   +L   S+KD   P L++
Sbjct: 131 QYKADNFYAPGCDGNIRWNDPVISIVWPMNPRVL---SDKDAAAPTLSE 176


>gi|188581603|ref|YP_001925048.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium populi
           BJ001]
 gi|179345101|gb|ACB80513.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium populi
           BJ001]
          Length = 183

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 1/177 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+ +  ++  D RGWFS+ Y + +L E G+ + FVQDN SFS   GTIRGLHFQ  P
Sbjct: 8   IPAVKRVIPKRHGDGRGWFSEVYRADVLAEHGIANAFVQDNQSFSAPAGTIRGLHFQVAP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQAKLVR +AG I D+AVD+R +SP+YG  V++ + A  G Q+++P GFAHGF TLE N
Sbjct: 68  NAQAKLVRVLAGAILDVAVDLRSDSPSYGRHVAVRLDAAGGEQLFVPAGFAHGFCTLEPN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           T V YKV  +YS   D  + W D +I I WP+ D     +S KD+  P L  +   F
Sbjct: 128 TMVAYKVDAYYSPADDRNLRWNDPAIGIEWPVADADA-ILSGKDKGAPLLADLGRVF 183


>gi|46202496|ref|ZP_00053128.2| COG1898: dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
           [Magnetospirillum magnetotacticum MS-1]
          Length = 186

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 120/179 (67%), Gaps = 5/179 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V++L  ++F D RG+F++TY++ +L E G+  VFVQDN SFS   G +RGLHFQR
Sbjct: 6   LAIPEVKVLTPKRFGDDRGFFAETYNAHILAEHGITAVFVQDNQSFSRPAGVVRGLHFQR 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KL+R + G I D  VDIR  SP++G  V++E+S+ +   I++P GFAHGFMTLE
Sbjct: 66  EPYAQDKLLRVVRGAILDAVVDIRPGSPSFGQAVTVELSSEDSASIFVPKGFAHGFMTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTI----LPSVSEKDQNLPFLNQI 175
            +TEV YKV+  Y+ E + G+ W+D  + I+WP LD I      +++ +DQ+   L  +
Sbjct: 126 PDTEVFYKVSYRYTPEAEGGIHWRDPDLAISWP-LDRIGGEGAVTIAARDQSFGLLRDL 183


>gi|159904979|ref|YP_001548641.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus maripaludis C6]
 gi|159886472|gb|ABX01409.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus maripaludis C6]
          Length = 187

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 6/177 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++ + F D RG+F ++Y S    + G+ + FVQDNHS S   G +RGLHFQ+
Sbjct: 8   LEIPEVILIEPKVFPDERGFFLESYKSSDFFDAGITENFVQDNHSKS-KYGVLRGLHFQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KLVRCI G IFD+AVD+R+NSP YG WV   +S  N   +YIP GFAHGF  L 
Sbjct: 67  NPKAQGKLVRCITGEIFDVAVDLRKNSPNYGKWVGEILSEENKKMLYIPKGFAHGFCVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            + E+IYK T+ Y+ E D+G+ W D +I+I WP++D   P +SEKD  LP  N +DS
Sbjct: 127 SDAEIIYKCTEEYAPECDAGIKWNDNAIEIDWPVVD---PIISEKDSLLP--NLLDS 178


>gi|296447932|ref|ZP_06889841.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylosinus trichosporium
           OB3b]
 gi|296254569|gb|EFH01687.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylosinus trichosporium
           OB3b]
          Length = 184

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 3/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I+  +KF D RG+FS+T++       GL   FVQDNHS S + G IRGLHFQ  P+AQ
Sbjct: 11  VKIVTPKKFGDERGFFSETHNQNKWDAHGLHYRFVQDNHSLSREVGVIRGLHFQTAPFAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + GRI D+AVDIRR+SPT+G  V++E+SA N  Q+ +P GFAH F TLE +TEV
Sbjct: 71  DKLVRVVRGRILDVAVDIRRSSPTFGRHVAVELSAENWRQLLVPIGFAHAFCTLEPDTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
            YKVT+FYS  +D G+A+ D  + I WP+ L+  +  +S+KD+  P L  +   F+
Sbjct: 131 FYKVTNFYSGANDRGLAFDDPDLGIDWPVALERAV--LSDKDRRWPRLRDLADAFD 184


>gi|163748303|ref|ZP_02155585.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oceanibulbus indolifex
           HEL-45]
 gi|161378422|gb|EDQ02909.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oceanibulbus indolifex
           HEL-45]
          Length = 189

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL   +  D+RG+FS+++++K L + GL   FVQDNHS S    T+RGLHFQ PP+AQ
Sbjct: 11  VLILTPVRHGDARGFFSESWNAKTLADAGLDYHFVQDNHSLSEAPNTLRGLHFQTPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G +FD+AVDIR  SP++G WV +++S  NG Q+ IP GF HGF+T    TE+
Sbjct: 71  AKLVRCGRGALFDVAVDIRHGSPSFGQWVGVDLSFENGRQLLIPAGFLHGFVTRVPMTEI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           IYK TD Y+ + D+ V W D  I I W L     P +S+KD + P L++I   F Y+
Sbjct: 131 IYKCTDTYAPDCDAAVRWDDPEIGIDWGLQGQT-PILSKKDASAPLLSEIVPHFTYE 186


>gi|92118532|ref|YP_578261.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nitrobacter hamburgensis X14]
 gi|91801426|gb|ABE63801.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nitrobacter hamburgensis X14]
          Length = 207

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 118/180 (65%), Gaps = 1/180 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V++++T +F D+RG+F +T+        GL   F+QDN S S   GT+RGLHFQR
Sbjct: 29  LAIPDVKLIRTPRFSDTRGYFCETFQRADFAAQGLDCDFLQDNQSSSDRPGTVRGLHFQR 88

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR + G I D+AVD+RR+S ++G  V++E+S+ +  Q+ +P GFAHGF TLE
Sbjct: 89  PPFAQTKLVRVLRGSILDVAVDLRRSSSSFGRHVAMELSSESNEQLLVPAGFAHGFCTLE 148

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T V YKV   YS  HDSGV W D  + I WP+  +   ++SEKD+ LP L  +   FE
Sbjct: 149 PDTVVFYKVDQVYSAAHDSGVNWADSRLGIEWPVA-SAEANLSEKDRGLPMLVDLAPVFE 207


>gi|259414800|ref|ZP_05738723.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Silicibacter sp. TrichCH4B]
 gi|259349251|gb|EEW60998.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Silicibacter sp. TrichCH4B]
          Length = 182

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 115/178 (64%), Gaps = 4/178 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V+IL   +F D RG+FS++++ + ++  G+   FVQDNHS S + GTIRGLHFQ P
Sbjct: 7   KLSGVKILTPARFGDERGFFSESWNRQRMEAHGIDLDFVQDNHSMSAEVGTIRGLHFQAP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVRC  G +FD+AVD+R  SPTYG WV +E++A NG Q+ +P GF HGF+T   
Sbjct: 67  PHAQDKLVRCGQGALFDVAVDVRVGSPTYGDWVGVELTAENGRQLLVPKGFLHGFITRAP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            TE+IYK TD+Y+ E D  V W    ID  W    T  P +SEKD     L    SPF
Sbjct: 127 MTEIIYKCTDYYAPECDGAVRWDSCGID--WGF--TGQPILSEKDTAAQALADFKSPF 180


>gi|330994213|ref|ZP_08318141.1| dTDP-4-dehydrorhamnose 3-5-epimerase [Gluconacetobacter sp. SXCC-1]
 gi|329758680|gb|EGG75196.1| dTDP-4-dehydrorhamnose 3-5-epimerase [Gluconacetobacter sp. SXCC-1]
          Length = 189

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 113/181 (62%), Gaps = 1/181 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            NI  + +L   +FED RG+F++TY++  LKE+G+ + FVQDNHS S   G +RGLH Q 
Sbjct: 6   FNIKGLVLLTPPRFEDDRGYFTETYNAARLKEIGITEPFVQDNHSLSRQRGVVRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRC  G I+D+ VDIR  SPT+G WV   +SA NG Q++IP GF HGF TL 
Sbjct: 66  PPHAQGKLVRCTRGSIWDVGVDIRAGSPTFGQWVGETLSAENGAQLWIPAGFLHGFCTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            N EV YK TDF++ E +  V W D  + I WP+       VS KD      + +D  F 
Sbjct: 126 DNAEVQYKCTDFWNRECERSVRWDDPLLAIDWPVA-AGEAIVSAKDAQALAFSSVDDWFT 184

Query: 181 Y 181
           +
Sbjct: 185 H 185


>gi|302340708|ref|YP_003805914.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta smaragdinae DSM
           11293]
 gi|301637893|gb|ADK83320.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta smaragdinae DSM
           11293]
          Length = 185

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 116/180 (64%), Gaps = 4/180 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  + ++K   F D RG+F +TY +   +  G+ ++FVQDNHS S     IRGLH Q+
Sbjct: 8   LAIEGLVVVKPHAFVDERGFFMETYKASAFQTAGIHEIFVQDNHSRS-RKNVIRGLHLQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PY+Q KLVRC+AG ++D+AVD+R  SPTY  W  LE+SA N L  ++P GFAHGF  L 
Sbjct: 67  NPYSQGKLVRCVAGVVWDVAVDLRVGSPTYKQWYGLELSAENRLMFFLPPGFAHGFAVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL-DTILPSVSEKDQNLPFLNQIDSPF 179
              E +YKVT  Y+ E D G+ W D  I I WP+  D +L  +SEKD+ LP+L+ ++ P+
Sbjct: 127 DTAESVYKVTAEYAPESDGGIRWNDPDIGIKWPISEDEVL--ISEKDRGLPWLSDLEEPY 184


>gi|329925154|ref|ZP_08280097.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. HGF5]
 gi|328939987|gb|EGG36320.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. HGF5]
          Length = 185

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 117/178 (65%), Gaps = 3/178 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+ ++    +D RG+F ++++ ++LK  G+ D F+QDNHS S + G IRGLH+Q  P  Q
Sbjct: 11  VKRIEPAVHQDHRGFFMESFNDRVLKGCGINDHFIQDNHSMSREAGVIRGLHYQLSPEGQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R ++G I+D+ VDIR  SPTYG W    +SA N +Q+ +P GFAHGF TL  +TEV
Sbjct: 71  TKLIRVVSGAIYDVVVDIRSGSPTYGQWQGFILSAANFIQLLVPKGFAHGFCTLVHDTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYKV  +YS EHD G+AW D  ++I WP+     P +S+KD   P L   ++ + Y+G
Sbjct: 131 IYKVDAYYSPEHDRGIAWNDPDLNIDWPVNK---PVLSDKDSKHPRLALAENNYIYEG 185


>gi|313894857|ref|ZP_07828417.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976538|gb|EFR41993.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 184

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 3/169 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           VRIL+ + F D+RGWF +++S K ++  G+   FVQDNHSFS + GT+RGLH+Q  P AQ
Sbjct: 11  VRILEPQVFGDARGWFMESWSQKKMENAGIHVDFVQDNHSFSAERGTLRGLHYQLNPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+R   G +FD+AVDIR  SPTY  W+ +E+SA N  Q++IP GFAHGF+TL  N EV
Sbjct: 71  AKLLRVSRGAVFDVAVDIRCGSPTYAQWIGIELSAENYRQLFIPRGFAHGFITLTDNVEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            YK  + Y+ + D  + W D +I + WP    +L   SEKD   P L +
Sbjct: 131 QYKADNLYAPDCDGNIRWDDPAIGVAWPFTPVVL---SEKDAIAPSLAE 176


>gi|294635550|ref|ZP_06714030.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Edwardsiella tarda ATCC
           23685]
 gi|291091119|gb|EFE23680.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Edwardsiella tarda ATCC
           23685]
          Length = 176

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 118/172 (68%), Gaps = 4/172 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + + F D RG+F +++S K+  E +G Q  FVQDNHS S   G +RGLHFQ 
Sbjct: 7   DIPDVLIFEPKVFGDDRGFFFESFSMKVFNEAVGRQVEFVQDNHSKS-SKGVLRGLHFQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC  G +FD+AVDIR +SPTYG W+ + +S  N  Q++IP GFAHGF+TL 
Sbjct: 66  SPYAQGKLVRCTVGEVFDVAVDIRESSPTYGKWIGVNLSGENKRQLWIPEGFAHGFLTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
              E +YK T++Y  +++SG+ W D ++ I+WP ++ ++  +S KD+NLP L
Sbjct: 126 DTAEFLYKATNYYRPDYESGIIWNDPTLSISWPEINGMI--ISTKDKNLPRL 175


>gi|33637049|gb|AAQ23686.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Geobacillus
           stearothermophilus]
          Length = 190

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 111/169 (65%), Gaps = 3/169 (1%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           ++D RG+F ++Y+ ++ ++LG    FVQDNHS S   GTIRGLH+Q  P AQ KLVR   
Sbjct: 22  YKDERGFFMESYNEQIFRKLGFDVRFVQDNHSLSVKAGTIRGLHYQLNPKAQTKLVRVTR 81

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G I+D+ VDIR+ SPT+G W    +S +N  Q+ +P GFAHGF TL  NTEV YKV ++Y
Sbjct: 82  GAIYDVIVDIRKGSPTFGKWKGFILSEDNKRQLLVPKGFAHGFCTLVENTEVQYKVDEYY 141

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           S EHD G+ W D ++ I WP+ + IL   SEKD N P L   +  F ++
Sbjct: 142 SPEHDRGILWNDPALSIDWPVTNPIL---SEKDANHPLLADAEINFVWE 187


>gi|297526883|ref|YP_003668907.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Staphylothermus hellenicus
           DSM 12710]
 gi|297255799|gb|ADI32008.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Staphylothermus hellenicus
           DSM 12710]
          Length = 185

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (66%), Gaps = 4/175 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M+I  V ++  + FED RG+F +TY     +  G++  FVQDNHS S   G +RGLHFQR
Sbjct: 8   MDIPDVVLIIPKVFEDERGFFMETYKKPDFERAGIRGNFVQDNHSRS-RYGVLRGLHFQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VRC+ G I+D+AVD+RRNS T+G +V + +S  N   +YIP GFAHGF+ L 
Sbjct: 67  EPYAQAKIVRCVRGVIYDVAVDLRRNSKTFGKYVGVILSEFNKYMLYIPRGFAHGFLVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              EVIYKV + Y+ E+++G+ W D  + I WP+ + IL   SEKD+  P L ++
Sbjct: 127 EEAEVIYKVDNLYAPEYEAGLIWNDPDVGIKWPIEEPIL---SEKDKKWPTLREL 178


>gi|152974748|ref|YP_001374265.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023500|gb|ABS21270.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cytotoxicus NVH
           391-98]
          Length = 182

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 118/173 (68%), Gaps = 3/173 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+ R FED RG+F+++Y+ K  ++LG+   F+QDN SFS   GT+RGLHFQ+ P AQ K
Sbjct: 13  LLQPRLFEDHRGFFTESYNWKEFQKLGVSYSFIQDNLSFSAKAGTVRGLHFQKEPKAQTK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           L++ + G I+D+ VD+R +SPTY  W    +S  N  Q+ +P GFAHGF TL  NT V+Y
Sbjct: 73  LIQVLKGAIYDVIVDLRVSSPTYKEWKGFILSEENHRQLLVPKGFAHGFCTLVPNTLVMY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
           KV ++YS +HD G+ W D+S+ ITWP+ + IL   SEKD+ LP  +Q    F+
Sbjct: 133 KVDEYYSSDHDDGLYWNDESLAITWPVSEPIL---SEKDKALPTFDQYHDCFK 182


>gi|220924209|ref|YP_002499511.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium nodulans ORS
           2060]
 gi|219948816|gb|ACL59208.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium nodulans ORS
           2060]
          Length = 184

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 117/178 (65%), Gaps = 2/178 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+++  ++F D RGWFS+T+ + +L + G+   F+QDN SFS   GT+RG+HFQ  P
Sbjct: 8   IPEVKLVIPKRFGDERGWFSETFRADILAQAGITAPFIQDNQSFSAHPGTVRGIHFQTHP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLVR +AG I D+AVD+RR SP+YG  V++ + A  G Q+YIP GF H F TLE N
Sbjct: 68  HAQAKLVRVLAGAILDVAVDLRRASPSYGRHVAVRLDAEAGHQLYIPIGFGHAFCTLEPN 127

Query: 123 TEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           T V YKV   +YS EHD  + W D ++ I WP +      +S+KD+  P L+ + + F
Sbjct: 128 TMVAYKVAGGYYSREHDGNLLWNDPALGIDWP-VSAEAAVLSDKDRAAPRLSDLPALF 184


>gi|298290100|ref|YP_003692039.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Starkeya novella DSM 506]
 gi|296926611|gb|ADH87420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Starkeya novella DSM 506]
          Length = 193

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 113/181 (62%), Gaps = 1/181 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++  +  D RG+F +TY        G+   FVQDN S S   G +RGLHFQ 
Sbjct: 7   LAIPDVVLVQPVRHGDGRGYFCETYKKPAFDAFGIDLAFVQDNESLSRPVGVVRGLHFQT 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP AQAKLVR + G IFD+AVDIRR SP+YG WV+  ++A  G Q+++P GFAHGF TLE
Sbjct: 67  PPMAQAKLVRVLRGAIFDVAVDIRRGSPSYGKWVAATLTAEEGNQLFMPHGFAHGFCTLE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T + YKV   YS  +D+G+AW D  + I WP+  T    +S+KD+  P L    SPF 
Sbjct: 127 PDTLIAYKVDAPYSRPNDAGIAWDDPDLAIDWPVT-TETAVLSDKDRVQPRLRDYASPFA 185

Query: 181 Y 181
           Y
Sbjct: 186 Y 186


>gi|254172754|ref|ZP_04879428.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus sp. AM4]
 gi|214032910|gb|EEB73738.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus sp. AM4]
          Length = 185

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++K + F D RG+F +TY     +  G++  FVQDNHS S   G +RGLHFQR
Sbjct: 8   LEIPDVILIKPKVFGDERGFFMETYKKPDFESAGIKGEFVQDNHSRS-RYGVLRGLHFQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VR + G I+D+AVD+R+NSPT+G WV + +S  N  Q+YIP GFAHGF+ L 
Sbjct: 67  EPYAQAKIVRVVRGVIYDVAVDLRKNSPTFGKWVGVILSEFNKWQLYIPRGFAHGFLVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              +VIYKV + Y+ +++ G+ W D  +DI WP+ +   P VSEKD+ LP L +
Sbjct: 127 DVADVIYKVDNVYAPDYEGGIIWNDPELDIDWPVDE---PIVSEKDRKLPTLRE 177


>gi|315231845|ref|YP_004072281.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus barophilus MP]
 gi|315184873|gb|ADT85058.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermococcus barophilus MP]
          Length = 185

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 119/175 (68%), Gaps = 4/175 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++K + FED RG+F +TY     ++ G++  FVQDNHS S   G +RGLHFQ+
Sbjct: 8   LEIPDVILIKPKVFEDERGFFMETYKKPDFEKAGIKGEFVQDNHSKS-KYGVLRGLHFQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VRCI G I+D+AVD+R+NSPT+G +V + +S  N   +YIP GFAHGF+ L 
Sbjct: 67  EPYAQAKIVRCIRGVIYDVAVDLRKNSPTFGKYVGVILSEYNKYMLYIPRGFAHGFVVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              EV+YKV + Y+ +++ G+ W D  ++I WP+ +   P VSEKD+  P L ++
Sbjct: 127 DVAEVVYKVDNVYAPDYEGGLIWNDPDVNIQWPVEN---PVVSEKDKRWPTLKEL 178


>gi|261405318|ref|YP_003241559.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. Y412MC10]
 gi|261281781|gb|ACX63752.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. Y412MC10]
          Length = 185

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 116/178 (65%), Gaps = 3/178 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+ ++    +D RG+F ++++ ++ K  G+ D F+QDNHS S + G IRGLH+Q  P  Q
Sbjct: 11  VKRIEPTVHQDHRGFFMESFNDRVFKGCGINDHFIQDNHSMSREAGVIRGLHYQLSPEGQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R ++G I+D+ VDIR  SPTYG W    +SA N LQ+ +P GFAHGF TL  +TEV
Sbjct: 71  TKLIRVVSGAIYDVVVDIRSGSPTYGQWQGFILSAANYLQLLVPKGFAHGFCTLVHDTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           IYKV  +YS EHD G+AW D  ++I WP+     P +S+KD   P L   ++ + Y+G
Sbjct: 131 IYKVDAYYSPEHDRGIAWNDPDLNIDWPVNK---PVLSDKDSKHPRLALAENNYIYEG 185


>gi|317130378|ref|YP_004096660.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cellulosilyticus DSM
           2522]
 gi|315475326|gb|ADU31929.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus cellulosilyticus DSM
           2522]
          Length = 226

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 116/176 (65%), Gaps = 3/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D+RG+F ++Y+ +  +++GL+   +QDNHS S + G +RGLH+Q  P AQ
Sbjct: 50  VVIIEPKVFGDNRGFFMESYNQEKFQQVGLKYKLIQDNHSLSVEPGVLRGLHYQLNPKAQ 109

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            K+VR   G I+D+ VDIR+ SPT+G W+   +S +N  QI +P GFAHGF TL  NT V
Sbjct: 110 TKIVRVATGAIYDVVVDIRKESPTFGEWIGAILSEHNKRQIVVPKGFAHGFCTLVPNTNV 169

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV ++YS EHD G+ W D  I I WP+ + IL   SEKD+  P L   D  F+Y
Sbjct: 170 LYKVDEYYSKEHDRGILWNDPDIGIEWPICNPIL---SEKDKVHPPLTGADINFQY 222


>gi|146293633|ref|YP_001184057.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella putrefaciens
           CN-32]
 gi|145565323|gb|ABP76258.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella putrefaciens
           CN-32]
          Length = 182

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 115/167 (68%), Gaps = 4/167 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V+I++ + F D RG+F ++++ +  +  +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   KIPDVKIIEPKVFGDERGFFFESFNQQQFEAAVGYSVKFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PPYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP+GFAHGF+TL 
Sbjct: 66  PPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGQWVGIHLSAENKRQLWIPSGFAHGFVTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
              E +YK T+FY+ + +  + W D  I I WPL+D   PS+S KDQ
Sbjct: 126 ETAEFLYKTTNFYAPQSEGSICWDDTDIGIEWPLVDK--PSLSSKDQ 170


>gi|170743901|ref|YP_001772556.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium sp. 4-46]
 gi|168198175|gb|ACA20122.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium sp. 4-46]
          Length = 184

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 116/179 (64%), Gaps = 2/179 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+++   +  D+RGWFS+TY + LL + G+ D+F+QDN SFS   GT+RG+HFQ  
Sbjct: 7   SIPDVKLVVPARHGDARGWFSETYRADLLAQAGITDLFIQDNQSFSAQVGTVRGIHFQTH 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVR ++G I D+AVD+RR SP+YG  V++ + A NG Q+Y+P GF H F TLE 
Sbjct: 67  PHAQGKLVRVVSGAILDVAVDLRRASPSYGRHVAVRLDAENGHQLYVPVGFGHAFCTLEP 126

Query: 122 NTEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +T + YKV+  +YS  HD  + W D  + I WP+       +S KD+  P L  + + F
Sbjct: 127 DTAIAYKVSGGYYSPAHDGALLWNDPDLGIDWPVSPEAA-ILSAKDKAAPRLADLPAHF 184


>gi|225848194|ref|YP_002728357.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644619|gb|ACN99669.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 189

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 4/181 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+K + F D RG+F + Y     K  G+   FVQDNHS S   G +RGLH+Q  
Sbjct: 9   EIPEVLIVKPKVFSDDRGFFLEFYKESEFKAAGIDTNFVQDNHSKSVK-GVLRGLHYQLN 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRCI G+IFD+AVDIR+ SPT+G +V++E+S  N L ++IP GFAHGF+ L  
Sbjct: 68  PKAQGKLVRCIKGKIFDVAVDIRKKSPTFGKYVAVELSEENKLMLWIPKGFAHGFLVLSE 127

Query: 122 NTEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E+IYKV+   YS EHD  + W D  I+I WP +DT  P +S+KD+  PFL   +  F 
Sbjct: 128 EAEIIYKVSGSEYSPEHDRAIRWNDPDINIKWP-IDT-YPILSQKDEKAPFLKDAEINFI 185

Query: 181 Y 181
           Y
Sbjct: 186 Y 186


>gi|253575947|ref|ZP_04853281.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251844741|gb|EES72755.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 182

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 119/180 (66%), Gaps = 3/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + +  V +L+     D RG+F ++Y+  +LK+LG+   FVQDN S S + G +RGLH+Q 
Sbjct: 6   LKLEGVFLLEPVVHGDHRGFFMESYNEAVLKQLGINYHFVQDNQSLSSEVGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQAKLVR + G I+D+ +DIRR+SPT+G W+ + +S  N  Q+ +P GFAHGF TLE
Sbjct: 66  NPKAQAKLVRVLTGAIYDVVLDIRRSSPTFGQWIGVTLSEANKRQLLVPKGFAHGFCTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT+V YKV ++YS EHD G+ W D ++ I WP+ +   P +S+KD+  P   + +  F+
Sbjct: 126 PNTQVFYKVDEYYSPEHDRGILWNDPALKINWPVSE---PLLSDKDRRHPTFAEAEMNFD 182


>gi|1314580|gb|AAC44073.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Sphingomonas sp. S88]
          Length = 188

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 113/171 (66%), Gaps = 1/171 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           K+ D RG+FS+ +    L   G++  +VQDN SFS   GTIRGLH Q PP+AQAKLVR +
Sbjct: 19  KYGDHRGFFSEVFKQSTLDAEGVEARWVQDNQSFSAAPGTIRGLHLQAPPFAQAKLVRVL 78

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G I+D+AVDIRR SPTYG WV +E+SA+   Q+ +P G+AHGFMTL  + E++YKV+  
Sbjct: 79  RGAIYDVAVDIRRGSPTYGQWVGVELSADKWNQLLVPAGYAHGFMTLVPDCEILYKVSAK 138

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           YS E +  + W D  + ITWP +  + P +SEKD       + ++PF Y G
Sbjct: 139 YSKESEMAIRWDDPDLAITWPDIG-VEPVLSEKDAVATPFAEFNTPFFYQG 188


>gi|307320269|ref|ZP_07599688.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti AK83]
 gi|306894148|gb|EFN24915.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium meliloti AK83]
          Length = 194

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 108/164 (65%), Gaps = 1/164 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           + ED RG+FS+T++ + L E G+   FVQDNHSFS   G +RGLH Q  PYAQ KLVR I
Sbjct: 21  RIEDERGFFSETWNERKLAEAGIALHFVQDNHSFSAAKGVLRGLHHQLSPYAQDKLVRVI 80

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G IFD+AVDIRR SPT+  WV+ E+SA    QI IP GF+HGF+TLE NTEVIYKVT+ 
Sbjct: 81  RGAIFDVAVDIRRGSPTFAQWVAAEVSARKWNQILIPKGFSHGFLTLEPNTEVIYKVTNP 140

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           YS  +D  + + D  I I WPL       +S KD   P L Q +
Sbjct: 141 YSPAYDRSIRFDDPEIAIAWPLPVAEF-QLSGKDAAAPPLGQAE 183


>gi|154247475|ref|YP_001418433.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthobacter autotrophicus
           Py2]
 gi|154161560|gb|ABS68776.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthobacter autotrophicus
           Py2]
          Length = 188

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 114/180 (63%), Gaps = 4/180 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++  V ++  R+F D+RG+F +TY   L    G+   FVQDN S S   GT+RGLH Q 
Sbjct: 7   LDLPEVILVTPRRFGDARGYFCETYVKPLYAANGIVADFVQDNESLSALPGTVRGLHMQA 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQAKLVR ++G IFD+AVD+R+ SPTYG W    ++A  G Q+++P GFAHGF TL 
Sbjct: 67  PPFAQAKLVRVLSGAIFDVAVDVRKGSPTYGRWAGARLTAEGGEQLFVPQGFAHGFCTLA 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL-DTILPSVSEKDQNLPFLNQIDSPF 179
            +T V YKV  FY    + G+ W D  + I W    +TIL   S+KD+ LP L   DSPF
Sbjct: 127 PDTRVAYKVDAFYDRASECGIIWNDPDLAIDWRFTGETIL---SDKDRILPRLKDFDSPF 183


>gi|89068412|ref|ZP_01155815.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Oceanicola granulosus
           HTCC2516]
 gi|89046066|gb|EAR52125.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Oceanicola granulosus
           HTCC2516]
          Length = 185

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 116/174 (66%), Gaps = 1/174 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL+ R+F D RGWF ++++ + L+  G++  FVQDNHS+S   GT+R LH+Q PP+AQ
Sbjct: 11  VLILEPRRFGDDRGWFMESWNRETLRGHGIEIDFVQDNHSYSAPKGTVRALHYQSPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVR   G + D+AVD RR SPTYG  V++++SA NG Q+++P GF HGF TL  + ++
Sbjct: 71  AKLVRVARGTVRDVAVDARRGSPTYGRHVAVDLSAENGRQLFVPAGFLHGFATLTPDVDL 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +YK +D Y+ + D  VAW D  + I W  +D +  ++S KD+  P      SPF
Sbjct: 131 LYKCSDIYAPDCDGAVAWDDPDLGIDWG-IDPVTATLSNKDRAAPQFADWTSPF 183


>gi|73809592|gb|AAZ85717.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli]
 gi|323948402|gb|EGB44386.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli H120]
 gi|324119067|gb|EGC12956.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli E1167]
          Length = 176

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 116/164 (70%), Gaps = 4/164 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKIFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G ++D+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVYDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y  E + G+ W DK+I+I WP++D  +P +S+KD N
Sbjct: 130 FVYKTTNYYHPESERGIIWDDKNINIHWPIVD--IPILSKKDHN 171


>gi|240138979|ref|YP_002963454.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           AM1]
 gi|240008951|gb|ACS40177.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           AM1]
          Length = 183

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (62%), Gaps = 5/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++  D RGWFS+ Y + +L E G+ + FVQDN SFS   GTIRGLHFQ  
Sbjct: 7   EIPAVKRVIPKRHGDDRGWFSEIYRADILSEHGIANAFVQDNQSFSAPAGTIRGLHFQVA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKL+R +AG I D+AVD+R +SP+YG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 67  PNAQAKLIRVLAGAILDVAVDLRSDSPSYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 127 DTMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 183


>gi|326402834|ref|YP_004282915.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
 gi|326403405|ref|YP_004283486.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
 gi|325049695|dbj|BAJ80033.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
 gi|325050266|dbj|BAJ80604.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium multivorum
           AIU301]
          Length = 184

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 3/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++  V ++   +F DSRGWFS+T++   L  LG  + FVQDNHS S   GTIRGLH Q 
Sbjct: 5   LDLPGVMLITPPRFADSRGWFSETWNQARLAALGFTETFVQDNHSSSTRPGTIRGLHCQL 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRCI G I+D+AVDIR  SP++G   + E+SA NG Q++IP GF HGF T E
Sbjct: 65  APFAQGKLVRCIRGAIWDVAVDIRHGSPSFGRHAAAELSAANGRQLWIPPGFLHGFCTTE 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPF 179
            +TEV+YKVT  Y    + GV W D  + + WP+   T L  +S+KD  LP L + +  F
Sbjct: 125 PDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPAGTAL--LSDKDNLLPRLAEAEPWF 182

Query: 180 E 180
            
Sbjct: 183 R 183


>gi|257792905|gb|ACV67282.1| RmlC [Escherichia coli]
          Length = 181

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 114/164 (69%), Gaps = 4/164 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++ K+  E +G +  FVQDNHS S   G +RGLH+Q+ PYA
Sbjct: 11  VLILEPKVFGDERGFFMESFNQKVFDEAVGRKVEFVQDNHSKSIK-GVLRGLHYQQEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIRR+S T+G WV + +SA N  Q++IP GFAHGF  L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRRDSETFGKWVGVNLSAENKKQLWIPEGFAHGFYVLSDTAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y+   D G+ W DK+I+I WP++  IL  +SEKD N
Sbjct: 130 FVYKATNYYNFLSDRGIIWNDKNININWPIVGDIL--LSEKDMN 171


>gi|220925351|ref|YP_002500653.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium nodulans ORS
           2060]
 gi|219949958|gb|ACL60350.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium nodulans ORS
           2060]
          Length = 184

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (65%), Gaps = 2/178 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+++  ++F D RGWFS+T+ + +L + G+   F+QDN SFS   GT+RG+HFQ  P
Sbjct: 8   IPEVKLVIPKRFGDERGWFSETFRADILAQAGITAPFIQDNQSFSAHPGTVRGIHFQTHP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLVR +AG I D+AVD+RR SP+YG  V++ + A  G Q+YIP GF H F TLE N
Sbjct: 68  HAQAKLVRVLAGAILDVAVDLRRASPSYGRHVAVRLDAEAGHQLYIPIGFGHAFCTLEPN 127

Query: 123 TEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           T V YKV   +Y+ EHD  + W D ++ I WP +      +S+KD+  P L+ + + F
Sbjct: 128 TMVAYKVAGGYYNREHDGNLLWNDPALGIDWP-VSAEAAVLSDKDRAAPRLSDLPALF 184


>gi|224823815|ref|ZP_03696924.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lutiella nitroferrum 2002]
 gi|224604270|gb|EEG10444.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lutiella nitroferrum 2002]
          Length = 181

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 121/175 (69%), Gaps = 5/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V+I++ + F D RG+F ++++ K  +E +G Q  FVQDNHS S   G +RGLH+Q P
Sbjct: 8   IPDVKIIEPQVFGDERGFFYESFNHKQFEEAIGQQVKFVQDNHSRSVK-GVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVRC  G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  PHAQAKLVRCAVGEVFDVAVDIRKSSPTFGQWVGVNLSAENKRQLWIPEGFAHGFLTLSK 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPFLNQI 175
             E +YK TD+Y+ E +  + W D+++ I WP      P++S+KD N L F +QI
Sbjct: 127 VAEFLYKTTDYYAPESERCINWNDQNLSIKWPT--GFDPTLSKKDNNGLAFTDQI 179


>gi|317132491|ref|YP_004091805.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ethanoligenens harbinense
           YUAN-3]
 gi|315470470|gb|ADU27074.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ethanoligenens harbinense
           YUAN-3]
          Length = 185

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (64%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++ R F D+RGWF +TYS + L  LG+   FVQDN SFS   GT+RGLHFQ  P
Sbjct: 8   LDGVLIVEPRVFGDNRGWFMETYSKEKLAPLGVTVDFVQDNQSFSAQKGTLRGLHFQMHP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ+KL+RC  G I D+AVDIR+ SP Y  WV++E+SA N  Q++IP GFAHGF+TL  +
Sbjct: 68  KAQSKLLRCTHGAILDVAVDIRKGSPNYTKWVAVELSAENKRQLFIPAGFAHGFVTLTDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            EV YKV ++Y+ + D  + + D +I + W +   IL   S+KD   P L   D  F Y
Sbjct: 128 VEVQYKVDEYYAPDCDRSIRFDDPAIGVNWGIKAPIL---SKKDLGAPLLADSDCNFTY 183


>gi|304405208|ref|ZP_07386868.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus curdlanolyticus
           YK9]
 gi|304346087|gb|EFM11921.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus curdlanolyticus
           YK9]
          Length = 181

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 115/173 (66%), Gaps = 3/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V +++T  F D RG+F+++Y+ +     G+   FVQDNHS S + GT+RGLHFQ  
Sbjct: 7   KLDGVLVIETNVFGDHRGFFTESYNEEKFLAAGIDYKFVQDNHSLSSEAGTVRGLHFQLA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVR +AG I+D+AVD+R++S TYG WV + +S +N  Q+ +P GFAHGF TL  
Sbjct: 67  PKAQTKLVRVVAGAIYDVAVDLRKDSSTYGQWVGVILSESNKRQLLVPQGFAHGFCTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           NT+V+YKV  +YS EHD G+ W D  I I WP    IL   S+KD+  P + +
Sbjct: 127 NTQVLYKVDAYYSQEHDRGLLWNDPDIGIEWPTDRVIL---SDKDKVHPGIRE 176


>gi|163853094|ref|YP_001641137.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           PA1]
 gi|163664699|gb|ABY32066.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           PA1]
          Length = 183

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 114/180 (63%), Gaps = 5/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ V+ +  ++  D RGWFS+ Y + +L E G+ + F+QDN SFS   GTIRGLHFQ  
Sbjct: 7   EISAVKRVIPKRHGDDRGWFSEIYRADILSEHGIANAFLQDNQSFSAPAGTIRGLHFQVA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKL+R +AG I D+AVD+R +SP+YG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 67  PNAQAKLIRVLAGAILDVAVDLRSDSPSYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 127 DTMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 183


>gi|303230617|ref|ZP_07317367.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514672|gb|EFL56664.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 178

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 117/172 (68%), Gaps = 3/172 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V IL+ R F D RG+F ++++ ++L ELG+   FVQDN SFS + GT+RG+HFQ  
Sbjct: 10  KLKGVYILEPRVFGDHRGYFFESWNERVLHELGIDINFVQDNQSFSAEQGTLRGIHFQTG 69

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQAKLVRC+ G + D+AVD+R +S TY  W+S+E+SA+N  Q+ IP GF HGF+TL  
Sbjct: 70  EWAQAKLVRCVRGAVLDVAVDLRADSSTYLQWISVELSADNKRQLLIPRGFGHGFVTLTP 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           + E +YK  +FY VE + G  W D +I + W + + IL   S+KD+ LPF+ 
Sbjct: 130 DVEFLYKADNFYHVEAEGGYRWNDPTIGVEWGIENPIL---SDKDKQLPFIK 178


>gi|319784647|ref|YP_004144123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170535|gb|ADV14073.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 184

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 114/172 (66%), Gaps = 1/172 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I+ V  +  ++  D+RG+F +TY+++   + G+   FVQDNHS+S   G +RGLH+Q 
Sbjct: 7   LGIDGVLEIVPKRHGDARGFFVETYNAERFSQAGIDLAFVQDNHSYSAAAGVLRGLHYQL 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R I G I D+AVDIRR+S T+G WV+LE+SA  G QI +P GFAHGF+TL 
Sbjct: 67  APRAQDKLLRVIRGSILDVAVDIRRSSKTFGKWVALEVSAEKGNQILVPKGFAHGFVTLV 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +TEV+YKVTD YS  HD  + + D +I I WP L      +S+KD   P L
Sbjct: 127 PDTEVLYKVTDTYSQAHDRSIRFDDPAIGIEWPSLTGGF-QLSDKDLKAPLL 177


>gi|254561587|ref|YP_003068682.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           DM4]
 gi|254268865|emb|CAX24826.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           DM4]
          Length = 183

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 112/180 (62%), Gaps = 5/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++  D RGWFS+ Y + +L E G+ + FVQDN SFS   GTIRGLHFQ  
Sbjct: 7   EIPAVKRVIPKRHGDDRGWFSEIYRADILSEHGIANAFVQDNQSFSAPAGTIRGLHFQVA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKL+R +AG I D+AVD+R  SP+YG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 67  PNAQAKLIRVLAGAILDVAVDLRSGSPSYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           +T V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 127 DTMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 183


>gi|9957837|gb|AAG09516.1|AF279619_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 181

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 117/168 (69%), Gaps = 4/168 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + + F D RG+F ++++ ++  E LG +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPDVLIFEPKVFGDKRGFFMESFNQRVFDEALGHKVEFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PPYAQ KLVRC+ G +FD+AVDIR++S T+G WV + +SA+N  Q++IP GFAHGF  L 
Sbjct: 66  PPYAQGKLVRCVVGEVFDVAVDIRKDSETFGKWVGVNLSADNKKQLWIPEGFAHGFYVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
              E++YK T++Y++  D G+ W D+SI+I WP+   IL  +SEKD N
Sbjct: 126 ETAELLYKTTNYYNLLSDRGIIWNDRSININWPISGDIL--LSEKDMN 171


>gi|260576534|ref|ZP_05844523.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sp. SW2]
 gi|259021257|gb|EEW24564.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sp. SW2]
          Length = 185

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 111/184 (60%), Gaps = 7/184 (3%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M I P     V IL   +F D+RGWFS+T+++  +   GL+  FVQDNHS S   GT+RG
Sbjct: 1   MQIEPTALADVMILTPARFGDARGWFSETWNAARMAAAGLRADFVQDNHSMSAAVGTLRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQ PP+AQ KLVRC  G IFD+AVDIRR S  YG WV +E++  N  Q+ +P GF HG
Sbjct: 61  LHFQAPPHAQDKLVRCTRGAIFDVAVDIRRGSKGYGKWVGVELTPENRRQLLVPKGFLHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+T   +TEV YK +DFY+ + D  V W   ++ I W L     P +S KD         
Sbjct: 121 FVTRLPDTEVQYKCSDFYAPDCDGAVRWDSAALAIDWGL--DCPPILSHKDAQAVDFADF 178

Query: 176 DSPF 179
            SPF
Sbjct: 179 SSPF 182


>gi|240140508|ref|YP_002964988.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           AM1]
 gi|240010485|gb|ACS41711.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           AM1]
          Length = 183

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 111/178 (62%), Gaps = 1/178 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V+ +  ++  D RGWFS+ Y + +L E G+ + FVQDN SFS   GTIRGLHFQ  
Sbjct: 7   EIPAVKRVIPKRHGDDRGWFSEVYRADILSEHGIANAFVQDNQSFSAPAGTIRGLHFQVA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKL+R +AG I D+AVD+R +SPTYG  V++ + A  G Q+++P GFAHGF TLE 
Sbjct: 67  PNAQAKLIRVLAGAILDVAVDLRSDSPTYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            T V YKV  +YS   D  + W D +I I WP+ +     +S KD+  P L  +   F
Sbjct: 127 ETMVAYKVDAYYSPADDRNLRWNDPAIGIEWPVAEAGA-ILSGKDKAAPLLADLGRVF 183


>gi|192360654|ref|YP_001983891.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cellvibrio japonicus Ueda107]
 gi|190686819|gb|ACE84497.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cellvibrio japonicus Ueda107]
          Length = 182

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 114/170 (67%), Gaps = 4/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I + + F D RG+F +++S +  +E  GL+  FVQDNHS S   G +RGLH+Q PP A
Sbjct: 11  VKIFEPKVFGDERGFFFESFSQRAFEEATGLKREFVQDNHSKS-SKGVLRGLHYQLPPMA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G +FD+AVDIR++SPT+G WV + +SA+N  Q++IP GFAHGF+TL    E
Sbjct: 70  QGKLVRVAQGEVFDVAVDIRKSSPTFGQWVGVILSADNKRQLWIPEGFAHGFLTLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            +YK T++YS  H+  + W D +++I WP  DT    +S KD+  P L Q
Sbjct: 130 FLYKTTNYYSPSHEGSIIWSDPTLNIQWP--DTSAVQISTKDRTAPILKQ 177


>gi|78357970|ref|YP_389419.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220375|gb|ABB39724.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 185

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 3/173 (1%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           ++ R F DSRG+F +++ ++L  E GL + FVQDNH+ S   G +RGLH Q PP AQ KL
Sbjct: 14  IRPRVFHDSRGFFLESFRARLFAEQGLPEEFVQDNHACSAQAGVVRGLHMQLPPAAQGKL 73

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           V    G +FD+A+D+R  SPTYG   +  +SA N L+++IP GFAHG+MTLE +TE  YK
Sbjct: 74  VWVTRGSVFDVALDLRTGSPTYGKAYTAVLSAANFLRLFIPRGFAHGYMTLEPHTEFQYK 133

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           V  +Y+ + ++G+ W D  +DI WP ++ +L   S KD  LP L    SPF Y
Sbjct: 134 VDAYYAPQAEAGIRWDDPDLDIPWPDMEAVL---SPKDAELPRLCDFASPFVY 183


>gi|158605286|gb|ABW74896.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Sphingomonas sp. ATCC 53159]
          Length = 188

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 112/171 (65%), Gaps = 1/171 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           K+ D RG+FS+ +   +L   G++  +VQDN SFS   GTIRGLH Q PP+AQAKLVR +
Sbjct: 19  KYGDHRGFFSEVFKQSVLDAEGVEARWVQDNQSFSAAPGTIRGLHLQAPPFAQAKLVRVL 78

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G IFD+AVDIRR SPTYG WV +E+SA    Q+ +P G+AHGFMTL  + E++YKV+  
Sbjct: 79  RGAIFDVAVDIRRGSPTYGKWVGVELSAEKWNQLLVPAGYAHGFMTLVPDCEILYKVSAK 138

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           YS + +  + W D  + I WP +  + P +SEKD       + ++PF Y G
Sbjct: 139 YSKDSEMAIRWDDPDLAIAWPDIG-VEPVLSEKDAVATPFAEFNTPFFYQG 188


>gi|154247480|ref|YP_001418438.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthobacter autotrophicus
           Py2]
 gi|154161565|gb|ABS68781.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthobacter autotrophicus
           Py2]
          Length = 185

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 111/176 (63%), Gaps = 2/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I   R F D+RG+FS+ +  +  ++      F+QDN S S   GT+RGLHFQ  P+AQ
Sbjct: 12  VKITPAR-FGDARGYFSEVFKDEWFRKNVSDSTFIQDNQSLSSTVGTVRGLHFQLDPFAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC AG IFD+AVDIR  SPT+G WV +E++  NG Q++IP GFAHGF TL  ++ +
Sbjct: 71  GKLVRCTAGAIFDVAVDIRVGSPTFGRWVGVELTPENGDQLWIPPGFAHGFATLVPDSVI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKVT  YS  HD G+ W D  I I WP L T    +SEKD+  P L  +   F Y
Sbjct: 131 FYKVTAPYSAAHDRGLLWNDPEIGIDWP-LKTGQAVLSEKDKVQPRLADLPPSFAY 185


>gi|126726120|ref|ZP_01741962.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705324|gb|EBA04415.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacterales bacterium
           HTCC2150]
          Length = 155

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 99/147 (67%), Gaps = 1/147 (0%)

Query: 39  FVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEI 98
           FVQDNHS S D GT+RGLHFQ PP+AQAKLVRC  GR+FD+AVDIR+ SPTYG WV  E+
Sbjct: 10  FVQDNHSMSADIGTVRGLHFQSPPHAQAKLVRCGRGRLFDVAVDIRKGSPTYGQWVGAEL 69

Query: 99  SANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTI 158
           S  NG Q+ +P GF HGF T E +TE+ YK TD+Y+ E D  V +    I I W L D I
Sbjct: 70  SFENGAQLLVPAGFLHGFSTREPDTEICYKCTDYYAPECDGAVRFDCPDIGIDWGLGD-I 128

Query: 159 LPSVSEKDQNLPFLNQIDSPFEYDGLP 185
              +S KD   P L   DSPF ++G P
Sbjct: 129 EAKLSGKDAAAPVLADFDSPFVWEGTP 155


>gi|241889232|ref|ZP_04776535.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gemella haemolysans ATCC
           10379]
 gi|241864069|gb|EER68448.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gemella haemolysans ATCC
           10379]
          Length = 190

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (64%), Gaps = 3/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   FED RG+F ++YS +  K+LG+   FVQDNHS S + G +RGLHFQR  
Sbjct: 8   LKDVKIIEPDVFEDERGFFMESYSEEKYKKLGIDFNFVQDNHSLSVEAGVVRGLHFQRGN 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R+ SPTYG W S  +S +N  Q+ +P GFAHGF TL  N
Sbjct: 68  AAQTKLIRVVTGEVLDVVVDLRKGSPTYGQWGSFILSEHNRRQLLVPRGFAHGFATLTPN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP--FE 180
              +YK  ++Y+ E D+G+A+ DK++ I W  +D     +S+KD+NLP   + +    FE
Sbjct: 128 VNFMYKCDNYYNAEADAGIAFDDKALGIDWQ-IDLSKAIISDKDRNLPTFKEFEKSNDFE 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|163851815|ref|YP_001639858.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           PA1]
 gi|163663420|gb|ABY30787.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacterium extorquens
           PA1]
          Length = 183

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 112/179 (62%), Gaps = 5/179 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+ +  ++  D RGWFS+ Y + LL E G+ + FVQDN SFS   GTIRGLHFQ  P
Sbjct: 8   IPAVKRVIPKRHGDDRGWFSEVYRADLLAERGIANAFVQDNQSFSAPAGTIRGLHFQVAP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQAKL+R +AG I D+AVD+R NS +YG  V++ + A  G Q+++P GFAHGF TLE +
Sbjct: 68  NAQAKLIRVLAGAILDVAVDLRSNSSSYGRHVAVRLDATGGEQLFVPAGFAHGFCTLEPD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
           + V YKV  +YS   D  + W D +I I WP+   D IL   S KD+  P L  +   F
Sbjct: 128 SMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAIL---SGKDKAAPLLADLGRVF 183


>gi|13476272|ref|NP_107842.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Mesorhizobium loti
           MAFF303099]
 gi|14027033|dbj|BAB53987.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Mesorhizobium loti
           MAFF303099]
          Length = 183

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 1/176 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I+ V  +  ++  D+RG+F +TY+++   + G+  VFVQDNHS+S   G +RGLH+Q 
Sbjct: 6   LGIDGVLEIVPKRHGDARGFFMETYNAERFSQAGIDLVFVQDNHSYSATAGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R I G I D+AVDIRR S T+G WV+ EISA  G QI +P GFAHGF+TL 
Sbjct: 66  EPRAQDKLLRVIRGSILDVAVDIRRGSKTFGKWVACEISAEKGNQILVPKGFAHGFVTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +TEV+YKVTD YS EHD  V + D  I I WP +      +S+KD   P L + +
Sbjct: 126 PDTEVLYKVTDTYSPEHDRSVRFDDPVIGIEWPSVAGGF-QLSDKDLKAPVLAEAE 180


>gi|295792732|gb|ADG29295.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus alvei]
          Length = 183

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F ++YS K L ELG+   F+QDN S S + G IRGLHFQ  P AQ KL+R I+G 
Sbjct: 21  DHRGFFMESYSKKKLNELGIYFNFIQDNQSLSLETGVIRGLHFQLNPKAQTKLIRVISGA 80

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           I+D+ VDIR++S T+G WV + +S +N  Q+ +P GFAHGF TL  NT+V+YKV ++YS 
Sbjct: 81  IYDVIVDIRKSSSTFGQWVGVILSEHNHRQLLVPKGFAHGFCTLTPNTQVLYKVDEYYSP 140

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           +HD G+ W D S+ I WP   T  P +S+KD+ LP L + +
Sbjct: 141 DHDRGIRWDDPSLGIDWP---TSKPILSDKDRLLPVLKEAE 178


>gi|283852391|ref|ZP_06369661.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio sp. FW1012B]
 gi|283572239|gb|EFC20229.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio sp. FW1012B]
          Length = 185

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++K R F D+RG+F +T+S K     GL   FVQDNH+ S   G +RGLH+QRPP  QAK
Sbjct: 13  VVKPRVFGDNRGFFLETHSRKAYAAAGLDYDFVQDNHARSGPRGVLRGLHYQRPPNTQAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV  + G +FD+AVD+R  SPTYG W  +E++ +N L++ +P GFAHG++TL  N E +Y
Sbjct: 73  LVWVVRGAVFDVAVDLRVGSPTYGKWYGIELTEDNFLRLMVPRGFAHGYVTLTENAEFMY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KV   YS   D+G+AW D  I + WP+    +P +S+KD   P L    SPF Y
Sbjct: 133 KVDAPYSPADDAGIAWNDPDIGVAWPV---DVPVLSDKDARQPTLAAGGSPFVY 183


>gi|148259626|ref|YP_001233753.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium cryptum JF-5]
 gi|148260219|ref|YP_001234346.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium cryptum JF-5]
 gi|146401307|gb|ABQ29834.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium cryptum JF-5]
 gi|146401900|gb|ABQ30427.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidiphilium cryptum JF-5]
          Length = 184

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (63%), Gaps = 3/181 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++  V ++   +F DSRGWFS+T++   L  LG  + FVQDNHS S   GTIRGLH Q 
Sbjct: 5   LDLPGVMLITPPRFADSRGWFSETWNQARLAALGFTETFVQDNHSSSTRPGTIRGLHCQL 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRCI G I+D AVDIR  SP++G   + E+SA NG Q++IP GF HGF T E
Sbjct: 65  APFAQGKLVRCIRGAIWDAAVDIRHGSPSFGRHAAAELSAANGRQLWIPPGFLHGFCTTE 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPF 179
            +TEV+YKVT  Y    + GV W D  + + WP+   T L  +S+KD  LP L + +  F
Sbjct: 125 PDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPAGTAL--LSDKDNLLPRLAEAEPWF 182

Query: 180 E 180
            
Sbjct: 183 R 183


>gi|289549232|ref|YP_003474220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermocrinis albus DSM 14484]
 gi|289182849|gb|ADC90093.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermocrinis albus DSM 14484]
          Length = 190

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 113/182 (62%), Gaps = 2/182 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++   F D RG+F + +     ++ G+   FVQDNHS S   G +RGLHFQ 
Sbjct: 8   LEIPDVVLIRPVVFTDERGFFMEIFKRSDFEKAGIDVDFVQDNHSRS-KKGVLRGLHFQL 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ GRIFD+AVD+R  SPTYG WV +E+S  N L ++IP GFAHGF+TL 
Sbjct: 67  EPYAQGKLVRCVKGRIFDVAVDLRSGSPTYGRWVGVELSEENHLMLWIPKGFAHGFLTLS 126

Query: 121 MNTEVIYKVTDF-YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
              +V+YKV+   Y  E D+G+ W D  I I WPL      ++S KD +LPFL      F
Sbjct: 127 EEADVLYKVSGAEYRPEADAGIRWNDPDIGIAWPLHLVENLTISPKDSSLPFLKDAKINF 186

Query: 180 EY 181
            Y
Sbjct: 187 RY 188


>gi|330829239|ref|YP_004392191.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas veronii B565]
 gi|328804375|gb|AEB49574.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas veronii B565]
          Length = 183

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 115/175 (65%), Gaps = 3/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ KL +E +G Q  FVQDNHS S   G +RGLH+Q P
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNHKLFEEAVGYQVNFVQDNHSKS-SKGVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRC+AG +FD+AVDIR++SPT+G WV + +S  N  Q++IP GFAHGF+TL  
Sbjct: 67  PNAQGKLVRCVAGEVFDVAVDIRKSSPTFGKWVGVHLSGENKRQLWIPEGFAHGFVTLTE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             E +YK T++Y+   D G+AW D SI I WP L+  + + S KD     L   D
Sbjct: 127 TAEFLYKTTNYYAPVSDRGIAWNDASIGIKWPELNADILT-SAKDSTAKSLETAD 180


>gi|315499263|ref|YP_004088067.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Asticcacaulis excentricus CB
           48]
 gi|315417275|gb|ADU13916.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Asticcacaulis excentricus CB
           48]
          Length = 180

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 113/174 (64%), Gaps = 1/174 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  + +L  +KF D+RG+F + + +   +E      FVQDN S S   GTIRGLH+Q+ 
Sbjct: 7   NIEGLALLTPKKFGDNRGYFMEAFKAAWFRESVADVTFVQDNQSLSGQVGTIRGLHYQKL 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P  Q KLVRC+ G IFD+AVDIR  S T+G WV   ++ +N LQ++IP GFAHGF TLE 
Sbjct: 67  PCGQGKLVRCLRGAIFDVAVDIRPESSTFGQWVGETLTPDNALQLWIPEGFAHGFCTLEP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           +TEV YKVT  YS  HD+G+A+ D  I I WP +D     +S+KD+  P L+ +
Sbjct: 127 DTEVFYKVTSPYSPTHDAGLAFDDPEIGIEWP-IDLAAAVLSDKDKVQPKLSSL 179


>gi|310644249|ref|YP_003949008.1| glucose-1-phosphate thymidylyltransferase [Paenibacillus polymyxa
           SC2]
 gi|309249200|gb|ADO58767.1| Glucose-1-phosphate thymidylyltransferase [Paenibacillus polymyxa
           SC2]
          Length = 182

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 118/180 (65%), Gaps = 3/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + +   +I++     D RG+F ++Y+ +++KE G+   F+QDN S S + G IRGLH+Q 
Sbjct: 6   LKLEGAKIIEPVVHGDHRGFFMESYNEQIMKENGIDHAFIQDNQSLSAEAGVIRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R ++G I+D+ +DIR++SPT+G WV + +S +N  Q+ +P GFAHGF TL 
Sbjct: 66  NPKAQTKLIRVLSGAIYDVILDIRKSSPTFGQWVGVILSEHNRRQLLVPKGFAHGFCTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT+V+YKV ++YS E+D G+ W D ++ I WP    IL   SEKDQ  P L   D  F+
Sbjct: 126 PNTQVLYKVDEYYSPENDRGILWNDPALGIDWPTSHAIL---SEKDQKHPALVNADINFD 182


>gi|288816245|gb|ADC54965.1| RmlC [Escherichia coli]
          Length = 183

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 114/167 (68%), Gaps = 6/167 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDC-GTIRGLHFQRPPY 63
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S  C G +RGLHFQ PP+
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS--CKGVLRGLHFQLPPF 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            QAKLVRCI G +FD+AVDIR NS T+G WV + +S+ N  Q++IP GFAHGF+TL    
Sbjct: 69  EQAKLVRCIVGEVFDVAVDIRPNSETFGSWVGVTLSSENKRQLWIPEGFAHGFLTLSEIA 128

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
           E +YK  ++YS  H+ GV W D+ I+I WP     +  +S+KD NLP
Sbjct: 129 EFVYKTNNYYSSNHERGVIWNDEEINIAWPSQSEKI--LSQKDINLP 173


>gi|332295247|ref|YP_004437170.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermodesulfobium narugense
           DSM 14796]
 gi|332178350|gb|AEE14039.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermodesulfobium narugense
           DSM 14796]
          Length = 188

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/182 (47%), Positives = 117/182 (64%), Gaps = 4/182 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I+K + F D RG+F +TY  +   + G+   FVQDNHS S   G +RGLH+Q  
Sbjct: 9   DIPEVMIVKPKVFGDERGFFLETYKREDFVKAGIYKEFVQDNHSKSVK-GVLRGLHYQLN 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRCI G+IFD+AVDIR+NSPT+  +VS+E+S  N   +++P GFAHGF+TL  
Sbjct: 68  PKAQGKLVRCIKGKIFDVAVDIRKNSPTFLKYVSVELSEENKFMLWVPEGFAHGFLTLSD 127

Query: 122 NTEVIYKVT-DFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E++YKV+   YS EHD  + W D  I I WPL     P +S+KD++ P L   D  F 
Sbjct: 128 EAEIMYKVSGSTYSPEHDRSLRWNDPEIGINWPLEGE--PILSKKDKDAPLLKNADINFV 185

Query: 181 YD 182
           Y+
Sbjct: 186 YE 187


>gi|308071021|ref|YP_003872626.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) [Paenibacillus polymyxa E681]
 gi|305860300|gb|ADM72088.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) [Paenibacillus polymyxa E681]
          Length = 181

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 116/174 (66%), Gaps = 3/174 (1%)

Query: 7   RILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +I++     D RG+F ++Y+ +++KE G+   F+QDN S S + G IRGLH+Q  P AQ 
Sbjct: 11  KIIEPVVHGDHRGFFMESYNEQIMKENGINYAFIQDNQSLSVETGVIRGLHYQLKPKAQT 70

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KL+R ++G I+D+ +DIR++SPT+G WV + +S +N  Q+ +P GFAHGF TL  NT+V+
Sbjct: 71  KLIRVLSGAIYDVILDIRKSSPTFGQWVGVILSEHNRRQLLVPKGFAHGFCTLVPNTQVL 130

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
           YKV ++YS E+D G+ W D ++ I WP    IL   SEKDQ  P L   D  F+
Sbjct: 131 YKVDEYYSPENDRGILWNDPALGIDWPTSHAIL---SEKDQKHPVLADADINFD 181


>gi|218662620|ref|ZP_03518550.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli
           IE4771]
          Length = 155

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 102/154 (66%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  +  +   +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ 
Sbjct: 1   MAIEGIVAITPPRFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQI 60

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRC+AGRI D+ VDIR  SP++G W+S E+S + G Q++IP GFAHGF T+E
Sbjct: 61  PPFAQGKLVRCLAGRIMDVVVDIRVGSPSFGKWLSQELSPDTGKQLWIPPGFAHGFATIE 120

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            N+ + YKVT  YS +HD G+AW D +I I W L
Sbjct: 121 PNSVISYKVTAPYSPQHDRGIAWNDPAIGIRWAL 154


>gi|299133409|ref|ZP_07026604.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Afipia sp. 1NLS2]
 gi|298593546|gb|EFI53746.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Afipia sp. 1NLS2]
          Length = 180

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 114/171 (66%), Gaps = 3/171 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V +++ + F D+RG+F ++++ +  +E      FVQDN SFS   G +RGLH+Q  P
Sbjct: 8   LDGVMLIEPQVFHDTRGYFFESFNHQRFRESVADVPFVQDNQSFS-KKGVVRGLHYQIAP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR +AG IFD+AVDIRRNSP +G W  + +SA+N  Q+++P GFAHGF  L   
Sbjct: 67  KAQGKLVRVLAGEIFDVAVDIRRNSPQFGQWTGINLSADNKKQLWVPAGFAHGFQVLSET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
            EV+YK TD++S EH+  + W D ++ I WPL   + P VS+KD + P L+
Sbjct: 127 AEVLYKTTDYWSAEHERAIRWNDPTLAIDWPL--KMNPVVSDKDNDAPLLS 175


>gi|9957848|gb|AAG09525.1|AF279621_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 176

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 114/166 (68%), Gaps = 5/166 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFSDERGFFMESFNQKVFEEAVGPKIEFVQDNHSKS-TKGVLRGLHYQVEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCIAG +FD+AVDIR++S T+G WV + +S+ N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCIAGEVFDVAVDIRKDSETFGKWVGVNLSSENKRQLWIPEGFAHGFLVLSEEAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            +YK +++YS EH+ G+ W D  I+ITW +   IL   S KD+N P
Sbjct: 130 FVYKTSNYYSAEHERGIIWNDTDINITWGIGSPIL---SLKDKNSP 172


>gi|167770814|ref|ZP_02442867.1| hypothetical protein ANACOL_02165 [Anaerotruncus colihominis DSM
           17241]
 gi|167666854|gb|EDS10984.1| hypothetical protein ANACOL_02165 [Anaerotruncus colihominis DSM
           17241]
          Length = 184

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 115/179 (64%), Gaps = 3/179 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V + +   F D RG+F +++S ++ +E GL   FVQDNHS S   GT+RG+HFQR 
Sbjct: 7   ELDGVYLAEPEVFGDHRGFFMESWSKRVFEEAGLFYDFVQDNHSCSTVKGTLRGIHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQAKLVRC+ G++ D+AVD+R NSP Y  WV++E+SA N  Q+ IP GF HGF+TL  
Sbjct: 67  DKAQAKLVRCVKGKVLDVAVDLRPNSPAYKRWVAVELSAENKKQLLIPRGFGHGFLTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             E +YK  ++Y+ E D G+ W D  + I W + +   P +S KDQN P+L    + FE
Sbjct: 127 EVEFLYKADNYYAPEADGGIRWNDPELAIDWGISE---PVLSGKDQNAPWLKDAATGFE 182


>gi|307340771|gb|ADN43834.1| RmlC [Escherichia coli]
          Length = 182

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 117/167 (70%), Gaps = 4/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E +YK T++Y+ +H+  + W+D  ++I+WP+ +   P +SEKD+N
Sbjct: 127 TAEFVYKTTNYYAAKHERCIQWKDGMLNISWPIGNA--PILSEKDRN 171


>gi|152971033|ref|YP_001336142.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150955882|gb|ABR77912.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 184

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  DPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 DTVQFVYKATNYYAPQSEQSIIWNDPEIGIDWPALSDCALSLSEKD 171


>gi|315923820|ref|ZP_07920049.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudoramibacter
           alactolyticus ATCC 23263]
 gi|315622853|gb|EFV02805.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudoramibacter
           alactolyticus ATCC 23263]
          Length = 188

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 112/181 (61%), Gaps = 3/181 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V ++  + F D RG+F +TYS+     +G+ ++FVQDN S++   GT+RG+HFQ  
Sbjct: 7   SIPGVCVVTPKVFGDRRGYFMETYSTAAFAAIGIDNIFVQDNRSYTAKKGTLRGIHFQNA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQAKLV  + G + D+AVD+R  SPTY  WV  E+SA N   ++IP GF HGF+TL  
Sbjct: 67  PMAQAKLVSVVRGTVMDVAVDLRAGSPTYRQWVGAELSAENKRMLFIPRGFGHGFVTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           + E  YKV + YS EHD G+ + D +I + W + D IL   SEKD   P L   D  F Y
Sbjct: 127 DVEFAYKVDNLYSPEHDRGIRFNDPAIGVDWGIADPIL---SEKDMTSPLLADSDCNFVY 183

Query: 182 D 182
           +
Sbjct: 184 E 184


>gi|46451854|gb|AAS98029.1| RmlC [Shigella boydii]
          Length = 177

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 118/173 (68%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++Y  E D G+ W D  I+I WP  + I+  +S+KD++ P L++
Sbjct: 127 TAEFLYKTTNYYHPESDRGIIWDDSFINIQWPYAECII--LSDKDKHQPRLSR 177


>gi|157161533|ref|YP_001458851.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli HS]
 gi|300946366|ref|ZP_07160644.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 116-1]
 gi|301643905|ref|ZP_07243934.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 146-1]
 gi|157067213|gb|ABV06468.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli HS]
 gi|300453958|gb|EFK17578.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 116-1]
 gi|301077725|gb|EFK92531.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 146-1]
          Length = 184

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVDFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  APHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 DTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALSDCALSLSEKD 171


>gi|32170823|gb|AAP57699.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Sphingomonas elodea]
          Length = 188

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 111/171 (64%), Gaps = 1/171 (0%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           KF D RG+FS+ +    L   G++  +VQDN SFS   GTIRGLH Q P +AQAKLVR +
Sbjct: 19  KFGDHRGFFSEVFKQSQLDAEGVEARWVQDNQSFSAAAGTIRGLHLQAPAFAQAKLVRVL 78

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G I+D+AVDIRR SPTYG WV +E+SA    Q+ +P G+AHGFMTL  + E++YKV+  
Sbjct: 79  PGAIYDVAVDIRRGSPTYGRWVGVELSAEKWNQLLVPAGYAHGFMTLVPDCEILYKVSAK 138

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           YS + +  + W D  + ITWP +  + P +SEKD       + ++PF Y G
Sbjct: 139 YSKDSEMAIRWDDPDLAITWPDIG-VEPVLSEKDAVATPFVEFNTPFFYQG 188


>gi|75758500|ref|ZP_00738621.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228904956|ref|ZP_04069008.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           4222]
 gi|74494027|gb|EAO57122.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228854698|gb|EEM99304.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           4222]
          Length = 194

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 113/179 (63%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++  K  D RG+F +TY+ K  + L LQ  FVQDN S S   GTIRGLH+Q  P
Sbjct: 14  LDGVFIIELDKCSDKRGYFIETYNKKKFELLDLQGEFVQDNQSLSVHTGTIRGLHYQLNP 73

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ K+V CI+G I+D+ VDIR+ SPTYG W    +S  N   + +P GFAHGF T+E N
Sbjct: 74  KAQMKVVSCISGSIYDVVVDIRKGSPTYGQWFGTILSEYNNRLLTVPKGFAHGFCTIEPN 133

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           T V YKV ++YS  H+ G+ W D++I I WP   T  P +SEKD+ LP L   +  F Y
Sbjct: 134 TIVQYKVDEYYSPNHEEGILWNDETIGIFWP---TNQPILSEKDRKLPRLKDTNINFVY 189


>gi|152971027|ref|YP_001336136.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150955876|gb|ABR77906.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 184

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  DPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 DTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALGDCALSLSEKD 171


>gi|221065027|ref|ZP_03541132.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni KF-1]
 gi|220710050|gb|EED65418.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni KF-1]
          Length = 183

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 116/177 (65%), Gaps = 3/177 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F +++   L  +  G    F+QDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVFLIEPKVFGDARGFFLESFRQDLFNQATGTNCEFIQDNHSRS-SKGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR I+G +FD+AVDIRRNSPT+G WV  E+SA N  Q++IP GFAHGF+ L
Sbjct: 65  LPPHAQGKLVRVISGAVFDVAVDIRRNSPTFGQWVGAELSAENHHQLWIPPGFAHGFVVL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               + +YK T +Y+ E D G+ W D  + I WP LD I  S+SEKD+N P   Q +
Sbjct: 125 SDTADFVYKTTAYYAPESDRGLLWNDPDLGIAWPQLD-IEFSLSEKDRNQPAFKQAE 180


>gi|88604302|ref|YP_504480.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanospirillum hungatei
           JF-1]
 gi|88189764|gb|ABD42761.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanospirillum hungatei
           JF-1]
          Length = 190

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 113/170 (66%), Gaps = 4/170 (2%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           F+DSRG+F ++Y+ K     G+ D FVQDNHS S   G +RGLH+Q P +AQ KLVR + 
Sbjct: 22  FKDSRGFFVESYNKKDFSHAGITDEFVQDNHSKS-QKGVLRGLHYQYP-HAQGKLVRVLK 79

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G I+D+AVDIR  SPTYG   ++ +  N+   +YIP GFAHGF+ LE +TEV+YKVTD Y
Sbjct: 80  GSIYDVAVDIRIGSPTYGKPFAVTLRENDPAMLYIPVGFAHGFLALEDDTEVMYKVTDLY 139

Query: 134 SVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               D+G+ W D  ++I WPL  +    P +SEKD   P L+++ SPF Y
Sbjct: 140 YPSGDAGLLWNDPDLNIPWPLDIIGIKEPILSEKDTKHPILSELRSPFTY 189


>gi|197106802|ref|YP_002132179.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phenylobacterium zucineum
           HLK1]
 gi|196480222|gb|ACG79750.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Phenylobacterium zucineum
           HLK1]
          Length = 184

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (64%), Gaps = 2/175 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + ++ V ++  ++  D+RGWFS+T+S + + E G++  FVQDN +F+   GT+RGLHFQ 
Sbjct: 7   LALSDVLLITPKRHGDARGWFSETWSRRAMSEAGVEADFVQDNQAFNARKGTLRGLHFQA 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ Q KLVR + G I+D+AVDIR  S TYG WV   ++A  G Q+++P GFAHG+ TL 
Sbjct: 67  APHPQGKLVRVLQGAIYDVAVDIRPGSATYGRWVGATLTAEGGEQLWVPRGFAHGYCTLT 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            +  + YKV   Y+ + + GVAW D  + I WPL     P +SEKD+ LP L  +
Sbjct: 127 DDAMLFYKVDGLYAPQTEGGVAWDDPDLAIDWPLESE--PVLSEKDKTLPRLKDL 179


>gi|168481430|gb|ACA24909.1| RmlC [Shigella dysenteriae]
          Length = 182

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 3/171 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I++ + F D RG+F ++++ KL  ++  + V FVQDNHS S   G +RGLH+Q P
Sbjct: 8   IPEVLIIEPQIFSDERGYFFESFNQKLFDDVVNRHVEFVQDNHSRS-SKGVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVRCI G +FD+AVDIR  SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  PFAQAKLVRCIVGEVFDVAVDIRTMSPTFGHWVGVRLSAENKRQLWIPEGFAHGFLTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
           N E  YK T+FY  E ++G+ W D  I+I WP  D +   +S KD  LP L
Sbjct: 127 NAEFAYKTTNFYCKEAEAGIIWNDPQINIKWP-EDNMEFLLSTKDVILPCL 176


>gi|260162574|dbj|BAI43815.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae]
          Length = 184

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  DPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 DTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALSDCALSLSEKD 171


>gi|170720580|ref|YP_001748268.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida W619]
 gi|169758583|gb|ACA71899.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida W619]
          Length = 182

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 113/168 (67%), Gaps = 4/168 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +   + F D RG+F +++++ + KE+ GLQ  FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVFLFTPKVFGDERGFFFESFNANVFKEVTGLQPDFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR + G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGF+TL
Sbjct: 65  LPPHAQGKLVRVVQGEVFDVAVDIRRSSPTFGQWVGAVLSAENKNQLWIPPGFAHGFVTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
               E +YK TDFYS   +  +AW D  I I WP+    +PS+S KDQ
Sbjct: 125 SDTAEFLYKTTDFYSPSSERCLAWNDPEIGIEWPI--DFVPSLSGKDQ 170


>gi|134046343|ref|YP_001097828.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus maripaludis C5]
 gi|132663968|gb|ABO35614.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus maripaludis C5]
          Length = 187

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (61%), Gaps = 4/181 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +++ + F D RG+F +TY      + G+ + FVQDNHS S   G +RGLHFQ 
Sbjct: 8   LKIPEVILIEPKVFPDERGFFLETYKFSDFFDAGITENFVQDNHSKS-KYGVLRGLHFQN 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KLVRCI G IFD+AVD+RRNSP YG WV   +S  N   +YIP GFAHGF  L 
Sbjct: 67  DPKAQGKLVRCIKGEIFDVAVDLRRNSPKYGKWVGEILSEENKKMLYIPNGFAHGFCVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              E+IYK T+ Y    D+G+ W D++I I WP++D   P +SEKD  LP L   +  F 
Sbjct: 127 SEAEIIYKCTEEYVPGCDAGILWNDETIGIDWPVVD---PIISEKDSLLPNLVDSNVNFR 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|50083371|ref|YP_044881.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Acinetobacter sp.
           ADP1]
 gi|49529347|emb|CAG67059.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Acinetobacter sp.
           ADP1]
          Length = 187

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 121/181 (66%), Gaps = 8/181 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKL----LKELGLQDV--FVQDNHSFSFDCGTIRGL 56
           I  + I + R F D RGWF ++++ ++    L E GL D+  FVQDNHSFS   G +RGL
Sbjct: 8   IKDLLIFEPRVFGDDRGWFMESFNQQVFEQALTERGL-DIPKFVQDNHSFS-KKGVLRGL 65

Query: 57  HFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGF 116
           H+Q  P+AQ KLVR + GR +D+AVDIR NS T+G WV +E++A+N  Q +IP GFAHGF
Sbjct: 66  HYQLNPHAQGKLVRVVQGRAWDVAVDIRENSSTFGEWVGVELTADNHKQFWIPAGFAHGF 125

Query: 117 MTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           + LE NT+ +YK TD+YS E +  + W D++I+I WP+   +   +++KD+  P L Q D
Sbjct: 126 IALEDNTQFLYKTTDYYSKECERSIVWNDETINIEWPIEKDLEILLTDKDRLAPQLIQAD 185

Query: 177 S 177
            
Sbjct: 186 K 186


>gi|169342322|ref|ZP_02863393.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens C
           str. JGS1495]
 gi|169299547|gb|EDS81610.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens C
           str. JGS1495]
          Length = 189

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 113/182 (62%), Gaps = 2/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++ + F D RG+F +TYS K  +E GL   FVQDN S S   G +RGLHFQ  
Sbjct: 10  KIKDLYIIEPKVFGDERGYFMETYSQKAFEEAGLTMKFVQDNESKS-KKGVLRGLHFQ-T 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR   G ++D+AVD+R+ SPT+G W  + +SA N  Q Y+P GFAHGF+ L  
Sbjct: 68  KHTQGKLVRVTQGEVWDVAVDLRKGSPTFGQWEGVHLSAENKRQFYVPEGFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
                YK TDFY+ E+DSG+ W DK +++ WPL       +SEKD+    L ++D PF Y
Sbjct: 128 EAVFNYKCTDFYAPEYDSGLLWNDKDVNVEWPLEGIEEIILSEKDKKQKTLKELDIPFVY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|56965452|ref|YP_177184.1| dTDP-dehydrorhamnose 3,5-epimerase [Bacillus clausii KSM-K16]
 gi|56911696|dbj|BAD66223.1| dTDP-dehydrorhamnose 3,5-epimerase [Bacillus clausii KSM-K16]
          Length = 181

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 110/172 (63%), Gaps = 3/172 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+   F D RG+F ++Y+    KE+G++  F+QDNHS S   GT+RGLH+Q  P AQ K
Sbjct: 13  LLEPTVFGDHRGFFMESYNKDTFKEIGIEIDFIQDNHSLSQTPGTLRGLHYQLAPKAQTK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           L+R   G I+D+ VDIR+ S TYG W    ++A N  Q+ +P GFAHGF TL  NTEV Y
Sbjct: 73  LIRATKGAIYDVIVDIRKESSTYGQWQGFILTAENKRQLLVPKGFAHGFCTLVENTEVQY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           KV + YS EHD G+AW D  + I WP+ + IL   S+KD   P L Q ++ F
Sbjct: 133 KVDELYSPEHDRGIAWDDPVLSIDWPVSNPIL---SDKDVKHPNLEQAENNF 181


>gi|114326768|ref|YP_743925.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314942|gb|ABI61002.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 188

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 111/181 (61%), Gaps = 1/181 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++   +F D+RG+FS+TY  +   E G+   FVQDNHS S   GTIRGLH Q 
Sbjct: 6   LAIPEVILVTPDRFGDNRGFFSETYQHRKYAEGGISGTFVQDNHSLSAQRGTIRGLHCQV 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  Q KLVRC+ G I+D+AVD R  SPTYG WV+ E+SA N  Q+++P GF H F TL+
Sbjct: 66  APNVQGKLVRCVRGAIWDVAVDARTGSPTYGQWVAAELSAENWQQLWVPGGFLHAFCTLQ 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +TEVIYKVT  Y    + GV W D  +D+ WP+    + + SEKD  LP  +     F 
Sbjct: 126 PDTEVIYKVTGDYDKSAERGVIWNDAELDLPWPVAPEEVVT-SEKDLQLPPFSAAKGWFT 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|54873720|gb|AAV41069.1| RmlC [Shigella boydii]
 gi|72003794|gb|AAZ65834.1| putative protein [Escherichia coli]
 gi|115503038|gb|ABI98963.1| RmlC [Escherichia coli]
 gi|332343819|gb|AEE57153.1| dTDP-4-dehydrorhamnose 3,5-epimerase RfbC [Escherichia coli UMNK88]
          Length = 181

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 116/174 (66%), Gaps = 4/174 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              E +YK T++Y    + GV W D  IDI WPL+ +  P +SEKD+   +L +
Sbjct: 126 ETAEFLYKTTNYYHPISERGVKWDDPCIDIKWPLVSS--PLLSEKDKCYSWLTK 177


>gi|9957853|gb|AAG09529.1|AF279622_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 177

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 113/168 (67%), Gaps = 4/168 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++  + +E +G +  FV DNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFSDERGFFMESFNQTVFEEAVGRKIEFVLDNHSKS-TKGVLRGLHYQVEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCIAG +FD+AVDIR++S T+G W+ + +S+ N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCIAGEVFDVAVDIRKDSETFGKWIGVNLSSENKRQLWIPEGFAHGFLVLSEEAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +YK T+FY+   D GVAW D  I I WPL++   P +S+KD   PFL
Sbjct: 130 FLYKTTNFYNPRSDRGVAWNDPYIGINWPLVNN--PLLSDKDSKQPFL 175


>gi|329929651|ref|ZP_08283348.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. HGF5]
 gi|328935977|gb|EGG32432.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus sp. HGF5]
          Length = 182

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 118/180 (65%), Gaps = 3/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++N   I++ +   DSRG+F ++Y+  L K+ G+   F+QDNHS S + G +RGLH+Q 
Sbjct: 6   LSLNGAAIIEPKVHGDSRGFFMESYNESLFKQNGITYNFIQDNHSLSAEPGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R + G I+D+ VDIR++S T+G W  + +S +N  Q+ +P GFAHGF TL 
Sbjct: 66  HPKAQTKLIRVLTGAIYDVIVDIRKSSSTFGQWYGVILSEHNHRQLLVPKGFAHGFCTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT+V+YKV ++YS E+D G+ W D ++ I WP   T  P +S+KDQ  P L   +  FE
Sbjct: 126 PNTQVLYKVDEYYSPENDRGILWNDPALGIDWP---TSSPILSDKDQRHPLLKDAEMNFE 182


>gi|34863497|gb|AAQ82927.1| dTDP-4-keto-6-deoxyglucose-3,5-epimerase [Raoultella terrigena]
          Length = 184

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 112/166 (67%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + R F D+RG+F +++SSK+  E +G +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPEVLICEPRVFGDARGFFFESFSSKIFDEAVGRKVEFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVD+RR+SPT+G WV + +SA N  Q++IP GFAHGFM L 
Sbjct: 66  APHAQGKLVRCVEGEVFDVAVDVRRSSPTFGQWVGVVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 ETVQFVYKATNYYAPQSERSILWNDPQIGIEWPELSGCALSLSEKD 171


>gi|262037148|ref|ZP_06010640.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia goodfellowii
           F0264]
 gi|261748836|gb|EEY36183.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia goodfellowii
           F0264]
          Length = 190

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F DSRG+F +TY+ K  +ELGL   FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IKDLVIIEPKVFGDSRGFFMETYNQKSFEELGLTMNFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I GR+FD+AVD+R+ S TYG W  +E+S  N L  Y+P  FAHGF+TL+ +
Sbjct: 69  HTQGKLVRVIKGRVFDVAVDLRKESETYGQWYGVELSEENKLMFYVPERFAHGFLTLDED 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD-TILP---SVSEKDQ 167
           TE +Y+ TD Y+ E+DSG+ W DK+++I W   +  I P   ++SEKDQ
Sbjct: 129 TEFVYRCTDLYAPEYDSGILWNDKTLNIDWKFEEFGINPEELTISEKDQ 177


>gi|168212616|ref|ZP_02638241.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens CPE
           str. F4969]
 gi|168216436|ref|ZP_02642061.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens NCTC
           8239]
 gi|182625737|ref|ZP_02953505.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens D
           str. JGS1721]
 gi|170715658|gb|EDT27840.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens CPE
           str. F4969]
 gi|177908999|gb|EDT71481.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens D
           str. JGS1721]
 gi|182381550|gb|EDT79029.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens NCTC
           8239]
          Length = 189

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 113/182 (62%), Gaps = 2/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++ + F D RG+F +TYS K  +E GL   FVQDN S S   G +RGLHFQ  
Sbjct: 10  KIKDLYIIEPKVFGDERGYFMETYSQKAFEEAGLTMKFVQDNESKS-KKGVLRGLHFQ-T 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR   G ++D+AVD+R+ SPT+G W  + +SA N  Q Y+P GFAHGF+ L  
Sbjct: 68  KHTQGKLVRVTQGEVWDVAVDLRKGSPTFGQWEGVHLSAENKRQFYVPEGFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
                YK TDFY+ E+DSG+ W DK +++ WPL       +SEKD+    L ++D PF Y
Sbjct: 128 EAVFNYKCTDFYAPEYDSGLLWNDKDVNVEWPLEGIEEIILSEKDKKQKTLKELDIPFIY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|71065772|ref|YP_264499.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychrobacter arcticus 273-4]
 gi|71038757|gb|AAZ19065.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychrobacter arcticus 273-4]
          Length = 190

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 112/174 (64%), Gaps = 6/174 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSK----LLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPP 62
           IL+ R FED RGWF ++++ K    LL E G +   FVQDNHS S   G +RGLH+Q  P
Sbjct: 13  ILEPRVFEDDRGWFMESFNHKSFTTLLNERGFEAPNFVQDNHSSS-QKGALRGLHYQLNP 71

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLVR + GR +D+AVDIR++SPT+G WV +E++A N  Q +IP GFAHGF+ LE N
Sbjct: 72  FAQAKLVRVVQGRAWDVAVDIRQHSPTFGQWVGIELTATNHRQFWIPAGFAHGFIALEDN 131

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           T+ +YK T +Y  E +  + W D S+DI WP+    L    +  Q   F   I+
Sbjct: 132 TQFLYKTTSYYHKESERTILWNDDSLDINWPVEGLELKLTEKDHQGATFTQAIE 185


>gi|83310573|ref|YP_420837.1| dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme
           [Magnetospirillum magneticum AMB-1]
 gi|82945414|dbj|BAE50278.1| dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme
           [Magnetospirillum magneticum AMB-1]
          Length = 184

 Score =  167 bits (422), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L+  +F DSRGWF +++S +  +E GL    ++DN S SF  GT+RGLHFQRPP AQ
Sbjct: 11  VLLLRPARFSDSRGWFMESWSHQAFREAGLDTEVIKDNVSLSFKTGTVRGLHFQRPPMAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL+   +GR+ D+AVD+R  S TYG  +S+E+SA  G  ++IP GFAHGF TLE NT V
Sbjct: 71  AKLISVYSGRVLDVAVDLRPGSATYGRHLSVELSAAEGTMLFIPKGFAHGFCTLEDNTLV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            YKV   YS EH+  + W+D  + I WP+
Sbjct: 131 GYKVDAPYSPEHEGAIHWRDPDLGIVWPV 159


>gi|157158061|ref|YP_001463389.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli E24377A]
 gi|157080091|gb|ABV19799.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli E24377A]
          Length = 182

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 114/169 (67%), Gaps = 4/169 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
             E +YK T++Y  E D G+ W D+ + ITWP  + +  ++S KDQ  P
Sbjct: 127 TAEFVYKTTNYYHPESDRGIRWDDEELSITWPRGNEL--NLSNKDQQHP 173


>gi|117624234|ref|YP_853147.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli
           APEC O1]
 gi|237704492|ref|ZP_04534973.1| RmlC [Escherichia sp. 3_2_53FAA]
 gi|300936658|ref|ZP_07151562.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 21-1]
 gi|115513358|gb|ABJ01433.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli
           APEC O1]
 gi|226900858|gb|EEH87117.1| RmlC [Escherichia sp. 3_2_53FAA]
 gi|300458239|gb|EFK21732.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 21-1]
 gi|323951790|gb|EGB47664.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli H252]
          Length = 182

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 117/175 (66%), Gaps = 4/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++S T+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSSTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             E +YK T++Y  + D G+ W D SI+I+WP+   +L  +S KD   P L +I+
Sbjct: 127 TAEFLYKTTNYYHPQSDRGIKWDDPSINISWPVDSQVL--LSAKDNKHPPLTKIE 179


>gi|315649766|ref|ZP_07902849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus vortex V453]
 gi|315274740|gb|EFU38121.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus vortex V453]
          Length = 182

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 119/180 (66%), Gaps = 3/180 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++N   +++ +   D RG+F ++Y+  L K+ G+   F+QDN S S + G +RGLH+Q 
Sbjct: 6   LSLNDALLIEPKVHGDHRGFFMESYNDSLFKQHGITYNFIQDNQSLSAEAGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+R + G I+D+ VDIR++SPT+G WV + +S +N  Q+ +P GFAHGF TL 
Sbjct: 66  NPKAQTKLIRVLTGAIYDVIVDIRKSSPTFGKWVGVILSEHNHRQLLVPKGFAHGFCTLV 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT+V+YKV ++YS E+D G+ W+D ++ I WP   T  P +S+KDQ  P L   +  F+
Sbjct: 126 PNTQVLYKVDEYYSPENDRGILWKDPALGIDWP---TSNPILSDKDQQHPLLKDAEMNFD 182


>gi|323960875|gb|EGB56495.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli H489]
          Length = 183

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 2/156 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ KL +E +G    FVQDNHS S   G +RGLH+Q P
Sbjct: 8   IPGVLIFEPKVFGDERGFFFESFNHKLFEEAVGYPVTFVQDNHSKS-SKGVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVRC+AG +FD+AVDIR++SP++G WV + +S  N  Q++IP GFAHGF+TL  
Sbjct: 67  PHAQGKLVRCVAGEVFDVAVDIRKSSPSFGQWVGVHLSGENKRQLWIPEGFAHGFVTLTE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDT 157
           + E +YK T++Y+   D G+AW D +I I WP L  
Sbjct: 127 SAEFLYKTTNYYAPASDRGIAWNDPTIGIRWPELKA 162


>gi|228994849|ref|ZP_04154646.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus pseudomycoides DSM
           12442]
 gi|228764896|gb|EEM13653.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus pseudomycoides DSM
           12442]
          Length = 171

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 110/168 (65%), Gaps = 3/168 (1%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           F D+RG+F ++Y+ K+L+ LG+   FVQDN S+S + G IRGLHFQ  P AQ KLV+ I 
Sbjct: 2   FHDARGYFKESYNEKVLRHLGIHHKFVQDNTSYSKEAGVIRGLHFQLEPRAQTKLVQVIQ 61

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G IFD+ VD+R+ SPTY  W S  ++ +N   + +P GFAHGF TL  +T V YKV +FY
Sbjct: 62  GAIFDVIVDLRKGSPTYKKWQSFLLTGDNHRLLLVPKGFAHGFCTLVPHTIVHYKVDEFY 121

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               DSG+AW D+   I+WP+ +   P +SEKD  LP  N+    F++
Sbjct: 122 DASCDSGIAWNDEEFAISWPVSN---PVLSEKDGMLPKFNETTHYFQF 166


>gi|323936932|gb|EGB33215.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli E1520]
          Length = 178

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 113/163 (69%), Gaps = 4/163 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S + G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-NKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            +YK T++Y  E D G+ W D+ I+I WP  +   P +S+KD+
Sbjct: 130 FLYKTTNYYHPESDRGIIWNDQDINIIWP--NIAEPLLSDKDK 170


>gi|260162548|dbj|BAI43790.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Klebsiella pneumoniae]
          Length = 184

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EIPDVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVDFVQDNHSQS-QKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  DPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L     S+SEKD
Sbjct: 126 DTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALGDCALSLSEKD 171


>gi|229825468|ref|ZP_04451537.1| hypothetical protein GCWU000182_00828 [Abiotrophia defectiva ATCC
           49176]
 gi|229790031|gb|EEP26145.1| hypothetical protein GCWU000182_00828 [Abiotrophia defectiva ATCC
           49176]
          Length = 193

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 117/175 (66%), Gaps = 2/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + F D+RGWF +++S K  +E+G+   FVQDNHSFS   GT+RGLHFQ+  
Sbjct: 13  IGGLFVIEPKVFGDNRGWFMESWSKKKFEEVGINCEFVQDNHSFSEKKGTLRGLHFQKGE 72

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+QAKLVR + GR++D+AVD+R++SPT+  W  +E+S  N  ++++P GFAHGF+TL  N
Sbjct: 73  YSQAKLVRVLRGRVYDVAVDLRKDSPTFLNWFGVELSEENKKELFVPRGFAHGFLTLTDN 132

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS--VSEKDQNLPFLNQI 175
            E  YK  ++Y+ E +  + + D+ I + W L D  +    VS+KD+  P   ++
Sbjct: 133 VEFAYKADNYYNKESEGAIRFDDEKIGVDWKLADLGVGEVIVSDKDKTAPGFEEL 187


>gi|110799633|ref|YP_695051.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens ATCC
           13124]
 gi|110800202|ref|YP_694935.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens ATCC
           13124]
 gi|168211917|ref|ZP_02637542.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens B
           str. ATCC 3626]
 gi|110674280|gb|ABG83267.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens ATCC
           13124]
 gi|110674849|gb|ABG83836.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens ATCC
           13124]
 gi|170710141|gb|EDT22323.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens B
           str. ATCC 3626]
          Length = 189

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 113/182 (62%), Gaps = 2/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++ + F D RG+F +TYS K  +E GL   FVQDN S S   G +RGLHFQ  
Sbjct: 10  KIKDLYIIEPKVFGDERGYFMETYSQKAFEEAGLTMKFVQDNESKS-KKGVLRGLHFQ-T 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR   G ++D+AVD+R+ SPT+G W  + +SA N  Q Y+P GFAHGF+ L  
Sbjct: 68  KHTQGKLVRVTQGEVWDVAVDLRKGSPTFGQWEGVHLSAENKRQFYVPEGFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
                YK TDFY+ E+DSG+ W DK +++ WPL       +SEKD+    L ++D PF Y
Sbjct: 128 EAVFNYKCTDFYAPEYDSGLLWNDKYVNVEWPLEGIEEIILSEKDKKQKTLKELDIPFIY 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|154707208|ref|YP_001423502.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii Dugway
           5J108-111]
 gi|154356494|gb|ABS77956.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii Dugway
           5J108-111]
          Length = 189

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++K + F D RG+F +T+     +  G+   F+QDNHS S   G +RGLH+Q 
Sbjct: 8   MPIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G++FD+AVD+RR SPT+G WVS E+S+ N   ++IP GFAHG + LE
Sbjct: 68  DPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFAHGMLVLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT ++YK T  Y  E +  + W D  I+I WP+ + +L  +SEKD    FL + +   +
Sbjct: 128 ENTHLLYKCTAEYVPESERYIRWDDPDINIKWPIKNNLL--LSEKDAAGVFLQRAEINAQ 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YHG 188


>gi|16765424|ref|NP_461039.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|141363|sp|P26394|RMLC_SALTY RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|7767043|pdb|1DZR|A Chain A, Rmlc From Salmonella Typhimurium
 gi|7767044|pdb|1DZR|B Chain B, Rmlc From Salmonella Typhimurium
 gi|7767045|pdb|1DZT|A Chain A, Rmlc From Salmonella Typhimurium
 gi|7767046|pdb|1DZT|B Chain B, Rmlc From Salmonella Typhimurium
 gi|581655|emb|CAA40118.1| rmlC [Salmonella enterica]
 gi|16420626|gb|AAL20998.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|261247309|emb|CBG25134.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267994148|gb|ACY89033.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158655|emb|CBW18167.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|323130417|gb|ADX17847.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332989029|gb|AEF08012.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 183

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +EL G +  FVQDNHS S     +RGLHFQR 
Sbjct: 9   IPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 68  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 128 YAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF--SQLPELSAKDAAAPLLDQ 178


>gi|85707416|ref|ZP_01038497.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius sp. 217]
 gi|85668072|gb|EAQ22952.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Roseovarius sp. 217]
          Length = 155

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (66%), Gaps = 1/154 (0%)

Query: 30  LKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPT 89
           + E GL   FVQDNHS S   GTIRGLHFQ PP+AQAKLVRC  G ++D+AVDIRR SPT
Sbjct: 1   MAEAGLTIDFVQDNHSLSEKVGTIRGLHFQSPPHAQAKLVRCGRGALYDVAVDIRRGSPT 60

Query: 90  YGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSID 149
           YG WV +++S  NG Q+ +P GF HGF+T E  TE+IYK +D+Y+ E D  V + D  I 
Sbjct: 61  YGHWVGVDLSFENGRQLLVPEGFLHGFVTREPMTEIIYKCSDYYAPECDGAVRFDDPEIG 120

Query: 150 ITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           ITW +    +  +S+KD   P L    SPFE+ G
Sbjct: 121 ITWGVEGESV-VLSDKDAKAPLLRDFVSPFEFVG 153


>gi|303244741|ref|ZP_07331071.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermococcus
           okinawensis IH1]
 gi|302484875|gb|EFL47809.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermococcus
           okinawensis IH1]
          Length = 185

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 118/180 (65%), Gaps = 6/180 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
            I  V ++K + F D RG+F +TY  +  +++G+   F+QDNHS S  C G +RGLHFQ+
Sbjct: 9   KIPEVILIKPKVFGDERGFFLETYKKEDFEKVGINGEFIQDNHSKS--CYGVLRGLHFQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQAK+VRCI G I+D+AVD+RR+SPT+G WV   +S  N  Q+YIP GFAHGF  L 
Sbjct: 67  EPYAQAKIVRCIRGVIYDVAVDLRRSSPTFGQWVGAVLSEYNKHQLYIPRGFAHGFCVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              EV+YKV + Y+ E++ GV W D  I I W L+D   P +S+KD+    L ++D   E
Sbjct: 127 GEAEVVYKVDNKYAPEYECGVIWNDGDIGIDW-LIDE--PILSDKDKQWHTLKELDKKGE 183


>gi|168481341|gb|ACA24827.1| RmlC [Escherichia coli]
 gi|320198728|gb|EFW73328.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli EC4100B]
          Length = 177

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 118/173 (68%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++Y  E D G+ W D  I+I WP  + I+  +S+KD++ P L++
Sbjct: 127 TAEFLYKTTNYYHPESDRGIIWDDSFINIQWPYDECII--LSDKDKHQPGLSR 177


>gi|167991009|ref|ZP_02572108.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168242167|ref|ZP_02667099.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194451405|ref|YP_002046144.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197261750|ref|ZP_03161824.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|194409709|gb|ACF69928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197240005|gb|EDY22625.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205330504|gb|EDZ17268.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338551|gb|EDZ25315.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|312913085|dbj|BAJ37059.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224742|gb|EFX49805.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 182

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +EL G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF--SQLPELSAKDAAAPLLDQ 177


>gi|264678894|ref|YP_003278801.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni CNB-2]
 gi|262209407|gb|ACY33505.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni CNB-2]
          Length = 185

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 119/183 (65%), Gaps = 4/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F +++   L  +  G    F+QDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVFLIEPKVFGDARGFFLESFRQDLFNQATGTNYEFIQDNHSRS-SKGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR I+G +FD+AVDIRR+SPT+G WV  E+SA N  Q++IP GFAHGF+ L
Sbjct: 65  LPPHAQGKLVRVISGAVFDVAVDIRRSSPTFGQWVGAELSAENHRQLWIPPGFAHGFVVL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
               + +YK T +Y+ E D G+ W D  I I WP LD I  S+SEKD++ P   Q +  F
Sbjct: 125 SDTADFVYKTTAYYAPESDRGLLWNDPDITIAWPQLD-IEFSLSEKDRHQPAFKQAEV-F 182

Query: 180 EYD 182
           E D
Sbjct: 183 EKD 185


>gi|205353237|ref|YP_002227038.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857530|ref|YP_002244181.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|205273018|emb|CAR37966.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206709333|emb|CAR33673.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326623928|gb|EGE30273.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628324|gb|EGE34667.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 183

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +EL G +  FVQDNHS S     +RGLHFQR 
Sbjct: 9   IPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 68  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 128 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 178


>gi|9957867|gb|AAG09540.1|AF279625_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 179

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 119/171 (69%), Gaps = 7/171 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFSDERGFFMESFNQKVFEEAVGRKIEFVQDNHSKS-TKGVLRGLHYQVEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC AG +FD+AVDIR++S T+G WV + IS+ N  Q++IP GFAHGF+ L  + +
Sbjct: 70  QGKLVRCTAGEVFDVAVDIRKDSETFGKWVGVNISSENKRQLWIPEGFAHGFLVLSDSAD 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLP-FLN 173
            +YK +++YS  H+ G+ W D +I+I WP+ +D IL   SEKD  LP F+N
Sbjct: 130 FLYKTSNYYSPVHERGIVWNDPTININWPINIDKIL---SEKDTILPKFIN 177


>gi|331668735|ref|ZP_08369583.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli TA271]
 gi|331063929|gb|EGI35840.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli TA271]
          Length = 179

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 116/173 (67%), Gaps = 6/173 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S  C G +RGLH+Q 
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS--CKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
              E +YK T++Y  E D G+ W D S+ I WPL +T  P +S +D+    L+
Sbjct: 126 ETAEFLYKTTNYYHPESDRGIIWNDPSLKIEWPLDNT--PVLSARDKAHSILD 176


>gi|29655125|ref|NP_820817.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 493]
 gi|161830572|ref|YP_001597662.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 331]
 gi|29542394|gb|AAO91331.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 493]
 gi|161762439|gb|ABX78081.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 331]
          Length = 189

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++K + F D RG+F +T+     +  G+   F+QDNHS S   G +RGLH+Q 
Sbjct: 8   MLIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G++FD+AVD+RR SPT+G WVS E+S+ N   ++IP GFAHG + LE
Sbjct: 68  DPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFAHGMLVLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT ++YK T  Y  E +  + W D  I+I WP+ + +L  +SEKD    FL + +   +
Sbjct: 128 ENTHLLYKCTAEYVPESERYIRWDDPDINIKWPIKNNLL--LSEKDAAGVFLQRAEINAQ 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YHG 188


>gi|161613226|ref|YP_001587191.1| hypothetical protein SPAB_00936 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551040|ref|ZP_02344795.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|198246059|ref|YP_002216181.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|161362590|gb|ABX66358.1| hypothetical protein SPAB_00936 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197940575|gb|ACH77908.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205324010|gb|EDZ11849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 182

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +EL G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 177


>gi|162149146|ref|YP_001603607.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545110|ref|YP_002277339.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787723|emb|CAP57319.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532787|gb|ACI52724.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 183

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 109/172 (63%), Gaps = 5/172 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  + +L  R+F D RG+FS+TY+ + + + G+   FVQDNHS S   G IRGLH Q 
Sbjct: 6   LSIPDILLLTPRRFADERGFFSETYNLRTMAQAGIDVAFVQDNHSLSRQRGVIRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRC  G I+D+AVD R+ SP++G WV+ E+S  NG Q++IP GF HGF TL 
Sbjct: 66  PPHAQGKLVRCTRGAIWDVAVDARQGSPSFGRWVAAELSEENGSQLWIPPGFLHGFCTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLP 170
            N EV YK TD +  + +  V W    + I WP+   D +L   SEKD   P
Sbjct: 126 ENAEVQYKCTDLWDRDCERSVRWNSPDLAIAWPVAPEDAVL---SEKDAAAP 174


>gi|288816201|gb|ADC54925.1| RmlC [Escherichia coli]
          Length = 182

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 117/175 (66%), Gaps = 4/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++S T+G WV + +SA N  Q++IP G+AHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSSTFGKWVGVNLSAENKRQLWIPEGYAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             E +YK T++Y  + D G+ W D SI+I+WP+   +L  +S KD   P L +I+
Sbjct: 127 TAEFLYKTTNYYHPQSDRGIKWDDPSINISWPVDSQVL--LSAKDNKHPPLTKIE 179


>gi|312142996|ref|YP_003994442.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Halanaerobium sp.
           'sapolanicus']
 gi|311903647|gb|ADQ14088.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Halanaerobium sp.
           'sapolanicus']
          Length = 183

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 110/175 (62%), Gaps = 3/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + IL    F D RGWF ++YS K  +ELG+   F+QDN+S+S   G +RGLHFQ  
Sbjct: 7   KIQGLYILSADVFADQRGWFMESYSLKKFRELGIDINFIQDNYSYSKKRGVLRGLHFQTE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ+KLVRCI GRI DIAVD+R+ S TY     + +S  N  Q+ IP GFAHGF+ LE 
Sbjct: 67  PKAQSKLVRCIKGRILDIAVDLRKESLTYKKHCKVLLSQKNKKQLLIPKGFAHGFICLED 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            TEV YKV ++Y  EH+  + + D  ++I W + + IL   S KD+N P L  ++
Sbjct: 127 ETEVYYKVDEYYFPEHEKSIFYNDPELNIDWEIENVIL---SNKDKNAPLLKDLE 178


>gi|24113423|ref|NP_707933.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           301]
 gi|30063489|ref|NP_837660.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|110806007|ref|YP_689527.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 5 str.
           8401]
 gi|331658118|ref|ZP_08359080.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli TA206]
 gi|585832|sp|P37780|RMLC_SHIFL RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|294899|gb|AAA53682.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri]
 gi|454901|emb|CAA50770.1| rfbD [Shigella flexneri]
 gi|24052446|gb|AAN43640.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           301]
 gi|30041742|gb|AAP17469.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|110615555|gb|ABF04222.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri 5 str.
           8401]
 gi|187880659|gb|ACD37161.1| RmlC [Escherichia coli]
 gi|187880668|gb|ACD37169.1| RmlC [Escherichia coli]
 gi|281601491|gb|ADA74475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri 2002017]
 gi|313649925|gb|EFS14345.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri 2a str.
           2457T]
 gi|331056366|gb|EGI28375.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli TA206]
 gi|332756671|gb|EGJ87020.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri K-671]
 gi|332756809|gb|EGJ87154.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri 2747-71]
 gi|332766383|gb|EGJ96592.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri 2930-71]
 gi|333002420|gb|EGK21982.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri K-218]
 gi|333002550|gb|EGK22111.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri VA-6]
 gi|333003378|gb|EGK22922.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri K-272]
 gi|333017072|gb|EGK36393.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri K-304]
 gi|333017208|gb|EGK36528.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri K-227]
          Length = 181

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 113/167 (67%), Gaps = 5/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF  L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFCVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E +YK  +FYS   + G+ W DKSI+I WP+ +   P +S+KD N
Sbjct: 127 EAEFVYKTNNFYSKMQERGILWSDKSINIEWPVQN---PLLSDKDIN 170


>gi|187880677|gb|ACD37177.1| RmlC [Escherichia coli]
          Length = 181

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 113/167 (67%), Gaps = 5/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF  L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFCVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E +YK  +FYS   + G+ W DKSI+I WP+ +   P +S+KD N
Sbjct: 127 EAEFVYKTNNFYSKMQERGILWSDKSINIEWPVQN---PLLSDKDIN 170


>gi|150400816|ref|YP_001324582.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus aeolicus
           Nankai-3]
 gi|150013519|gb|ABR55970.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcus aeolicus
           Nankai-3]
          Length = 185

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 4/179 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ V ++K + F D RG+F +TY  +  +  G++  FVQDNHS S   G +RGLHFQ+ 
Sbjct: 9   KISEVILIKPKIFGDERGFFLETYEKEDFENAGIKGEFVQDNHSKSCH-GVLRGLHFQKE 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQAK+VRCI G IFD+AVD+R +SPT+G WV + +S  N  Q+YIP GFAHGF  L  
Sbjct: 68  PYAQAKIVRCIKGVIFDVAVDLRGSSPTFGQWVGVVLSEYNKHQLYIPRGFAHGFCVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             EV+YKV + Y+ E + GV W D+ I I W L+D   P +S+KD+    L ++D   E
Sbjct: 128 EAEVVYKVDNKYAPECECGVIWNDEDIGIDW-LIDE--PILSDKDKQWHTLKELDEKGE 183


>gi|115503048|gb|ABI98972.1| RmlC [Escherichia coli]
          Length = 177

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%), Gaps = 4/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLK-ELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +  +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKVFEVAVGRKVEFVQDNHSKS-RKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            +YK T++Y  E D G+ W DK I++ WP  +  +  +S KD+ LP L +
Sbjct: 130 FLYKTTNYYHPESDRGIIWDDKFINVEWPPYENYI--LSAKDKTLPPLTK 177


>gi|73809580|gb|AAZ85706.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
          Length = 178

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/165 (47%), Positives = 113/165 (68%), Gaps = 4/165 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             + +YK T++Y  E +SG+ W D +IDI WP+ +   P +S KD
Sbjct: 127 TADFLYKTTNYYHPESESGLLWNDYTIDIAWPIENE--PLLSAKD 169


>gi|264680360|ref|YP_003280270.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni CNB-2]
 gi|262210876|gb|ACY34974.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni CNB-2]
          Length = 183

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 115/177 (64%), Gaps = 3/177 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F +++   L  +  G    F+QDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVFLIEPKVFGDARGFFLESFRQDLFNQATGTNHEFIQDNHSRS-SKGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
             P+AQ KLVR I+G +FD+AVDIRR+SPT+G WV  E+SA N  Q++IP GFAHGF+ L
Sbjct: 65  LSPHAQGKLVRVISGTVFDVAVDIRRSSPTFGQWVGAELSAENHRQLWIPPGFAHGFVVL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               + +YK T +Y+ E D G+ W D  I I WP LD I  S+SEKD+N P   Q +
Sbjct: 125 SDTADFVYKTTAYYAPESDRGLLWNDPDIAIAWPQLD-IEFSLSEKDRNQPAFKQAE 180


>gi|153206209|ref|ZP_01945472.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212217811|ref|YP_002304598.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii CbuK_Q154]
 gi|120577339|gb|EAX33963.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212012073|gb|ACJ19453.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii CbuK_Q154]
          Length = 189

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++K++ F D RG+F +T+     +  G+   F+QDNHS S   G +RGLH+Q 
Sbjct: 8   MPIPEVILIKSKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G++FD+AVD+RR SPT+G WVS E+S+ N   ++IP GFAHG + LE
Sbjct: 68  DPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFAHGMLVLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT ++YK T  Y    +  + W D  I+I WP+ + +L  +SEKD    FL + +   +
Sbjct: 128 ENTHLLYKCTAEYVPASERYIRWDDPDINIKWPIKNNLL--LSEKDAAGVFLQRAEINAQ 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YHG 188


>gi|168236252|ref|ZP_02661310.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734639|ref|YP_002115183.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710141|gb|ACF89362.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197290480|gb|EDY29835.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 182

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 177


>gi|9957818|gb|AAG09501.1|AF279615_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 179

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 119/171 (69%), Gaps = 7/171 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFSDERGFFMESFNQKVFEEAVGRKIEFVQDNHSKS-TKGVLRGLHYQVEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCIAG +FD+AVDIR++S T+G WV + IS+ N   ++IP GFAHGF+ L  + +
Sbjct: 70  QGKLVRCIAGEVFDVAVDIRKDSETFGKWVGVNISSENKRPLWIPEGFAHGFLVLSDSAD 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLP-FLN 173
            +YK +++YS  H+ G+ W D +I+I WP+ +D IL   SEKD  LP F+N
Sbjct: 130 FLYKTSNYYSPIHERGIVWNDPTININWPINIDKIL---SEKDTILPKFIN 177


>gi|291562823|emb|CBL41639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [butyrate-producing bacterium
           SS3/4]
          Length = 191

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 112/182 (61%), Gaps = 5/182 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  + +++   F D RG+F +TY+    KE GL  VFVQDN S S   G +RGLHFQ+
Sbjct: 14  MVIEGLHVIEPTVFNDERGYFMETYNQNDFKEAGLNMVFVQDNQSMSVK-GVLRGLHFQK 72

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             + Q KLVR + G +FD+AVD+R +S TYG W  +E+SA N  Q YIP GFAHGF+ L 
Sbjct: 73  Q-FPQGKLVRAVRGTVFDVAVDLRTHSKTYGKWFGVELSAENKKQFYIPEGFAHGFVVLS 131

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              E  YK TDFY    + G+AW D++I + WP+   +   +SEKDQ  P   +I   F+
Sbjct: 132 DEAEFAYKCTDFYHPGDEGGLAWNDETIGVKWPITPDMQLIISEKDQKWPGFKEI---FK 188

Query: 181 YD 182
           +D
Sbjct: 189 FD 190


>gi|16588697|gb|AAL26875.1|AF315583_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Acinetobacter calcoaceticus]
          Length = 186

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (65%), Gaps = 6/170 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYS----SKLLKELGLQ-DVFVQDNHSFSFDCGTIRGLH 57
           I  + IL    F D RGWF ++++    ++ L+ELGL    FVQDNHS S   G +RGLH
Sbjct: 8   IEGLLILHPNVFGDDRGWFMESFNQQRFAQALEELGLSVPTFVQDNHSLS-QKGVLRGLH 66

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           +Q  PYAQ KLVR + GR++D+AVDIR +S TYG WV +E+SA N    +IP GFAHGF+
Sbjct: 67  YQNAPYAQGKLVRVVQGRVWDVAVDIRPDSKTYGEWVGVELSAENKTMFWIPEGFAHGFI 126

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           +LE NT+ +YK T++Y+ E +  + W D ++ I WPL       VS+KDQ
Sbjct: 127 SLEDNTQFLYKTTNYYNKESEGAIIWNDPTLAIDWPLAKVDEVLVSDKDQ 176


>gi|168818217|ref|ZP_02830217.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344842|gb|EDZ31606.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320086526|emb|CBY96297.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 176

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 109/158 (68%), Gaps = 2/158 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFSDERGFFMESFNQKVFEEAVGRKIEFVQDNHSKS-TKGVLRGLHYQVE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRCIAG +FD+AVDIR++S T+G WV + IS+ N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCIAGEVFDVAVDIRKDSETFGKWVGVNISSENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL 159
             E +YK +++YS EH+ G+ W D  I+ITW +   IL
Sbjct: 127 EAEFVYKTSNYYSGEHERGIIWNDPDINITWGIDSPIL 164


>gi|331647689|ref|ZP_08348781.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli M605]
 gi|330911875|gb|EGH40385.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli AA86]
 gi|331043413|gb|EGI15551.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli M605]
          Length = 179

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 109/152 (71%), Gaps = 2/152 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKIFEEAVGRKVEFVQDNHSKS-RKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL+ 
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLTLKD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP 153
           NTE++YK T +YS E++  + W D+ + I WP
Sbjct: 127 NTEILYKTTSYYSPEYERSIIWNDEDLVIKWP 158


>gi|16761026|ref|NP_456643.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141278|ref|NP_804620.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|25292478|pir||AC0767 dTDP-4-dehydrorhamnose 3,5-epimerase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503324|emb|CAD02457.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136904|gb|AAO68469.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 183

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 9   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 68  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 128 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 178


>gi|315640669|ref|ZP_07895773.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus italicus DSM
           15952]
 gi|315483565|gb|EFU74057.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus italicus DSM
           15952]
          Length = 193

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 3/178 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS K  KE G+   F+QDNHS S + G +RGLHFQ+   AQ
Sbjct: 14  VKIIEPVVFGDHRGFFTESYSDKDFKEAGIDFDFIQDNHSLSTEPGVLRGLHFQKGQAAQ 73

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +SA+N  Q+ +P G+AHGF+TL  N   
Sbjct: 74  TKLIRVVTGAVLDVIVDIRKGSPTYGEWEGYILSASNHRQLLVPKGYAHGFVTLTDNVNF 133

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS--PFEY 181
           +YK  ++Y+ E D G+A+ D  + ITWP +D     +SEKD++ P L + ++  PF Y
Sbjct: 134 LYKCDNYYNAEADGGIAFDDPELAITWP-IDQSKAILSEKDKHHPTLKEFEAENPFVY 190


>gi|56413002|ref|YP_150077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197361930|ref|YP_002141567.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127259|gb|AAV76765.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093407|emb|CAR58862.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 180

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 6   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 64

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 65  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 125 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 175


>gi|197248407|ref|YP_002147052.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197212110|gb|ACH49507.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 182

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF--SQLPELSAKDAAAPLLHQ 177


>gi|213052828|ref|ZP_03345706.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213419660|ref|ZP_03352726.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213425548|ref|ZP_03358298.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213620978|ref|ZP_03373761.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650448|ref|ZP_03380501.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852951|ref|ZP_03382483.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289807299|ref|ZP_06537928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289827039|ref|ZP_06545847.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
          Length = 182

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 177


>gi|165918222|ref|ZP_02218308.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 334]
 gi|165918082|gb|EDR36686.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii RSA 334]
          Length = 189

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++K + F D RG+F +T+     +  G+   F+QDNHS S   G +RGLH+Q 
Sbjct: 8   MPIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G++FD+AVD+RR SPT+G WVS E+S+ N   ++IP GFAHG + LE
Sbjct: 68  DPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFAHGMLVLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT ++YK T  Y    +  + W D  I+I WP+ + +L  +SEKD    FL + +   +
Sbjct: 128 ENTHLLYKCTAEYVPASERYIRWDDPDINIKWPIKNNLL--LSEKDAAGVFLQRAEINAQ 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YHG 188


>gi|254853034|ref|ZP_05242382.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           R2-503]
 gi|300765929|ref|ZP_07075902.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           N1-017]
 gi|258606382|gb|EEW18990.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           R2-503]
 gi|300513391|gb|EFK40465.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           N1-017]
          Length = 186

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 110/174 (63%), Gaps = 3/174 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++K + F D RG+F ++Y+ K   E+G+   F+QDNHS S + G +RG+H+Q  P AQ
Sbjct: 11  VKLVKPKVFGDHRGFFMESYNEKAFHEVGIDMKFIQDNHSLSVEAGVLRGMHYQTNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R   G I+D+ VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF T+  N  V
Sbjct: 71  TKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHGFCTITENVNV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +YKV   YS E+D+G+A+ D  ++ITWP    IL   S+KD   P L   ++ F
Sbjct: 131 LYKVDQLYSPENDAGIAYDDPDLNITWPTDKLIL---SDKDTKHPRLKDAENNF 181


>gi|228946127|ref|ZP_04108462.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228813540|gb|EEM59826.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 194

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 112/179 (62%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++  K  D RG+F +T + K  + L LQ  FVQDN S S   GTIRGLH+Q  P
Sbjct: 14  LDGVFIIELDKCSDKRGYFIETCNKKKFELLDLQGDFVQDNQSLSVHTGTIRGLHYQLNP 73

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ K+V CI+G I+D+ VDIR+ SPTYG W    +S  N   + +P GFAHGF T E N
Sbjct: 74  KAQMKVVSCISGSIYDVVVDIRKGSPTYGQWFGTILSEYNNRLLTVPKGFAHGFCTTEPN 133

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           T V YKV ++YS +H+ G+ W D++I I WP   T  P +SEKD+ LP L   +  F Y
Sbjct: 134 TIVQYKVDEYYSPKHEGGILWNDETIGIFWP---TNQPILSEKDRKLPRLKDTNVNFVY 189


>gi|198275009|ref|ZP_03207541.1| hypothetical protein BACPLE_01168 [Bacteroides plebeius DSM 17135]
 gi|198272456|gb|EDY96725.1| hypothetical protein BACPLE_01168 [Bacteroides plebeius DSM 17135]
          Length = 187

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 113/184 (61%), Gaps = 6/184 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D+RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQRPP
Sbjct: 8   IEGVVIIEPRIFKDARGYFFESFSQREFEEKVGKINFVQDNESMS-SYGVMRGLHFQRPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELTEDNHRQFFIPQGFAHGFAVLSET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY  E D G++  D S+ I W  P    IL   SEKD   P L   DSPFE
Sbjct: 127 AIFQYKCDNFYHPEADGGISILDDSLGIDWRIPTEHAIL---SEKDTKHPLLKDFDSPFE 183

Query: 181 YDGL 184
           +   
Sbjct: 184 FGAF 187


>gi|22759341|gb|AAC70776.2| dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase [Klebsiella pneumoniae]
          Length = 184

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + R F D+RG+F +++SSK+  E +G Q  FVQDNHS S     +RGLH+Q 
Sbjct: 7   DIPDVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQS-QKRVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+ G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGFM L 
Sbjct: 66  DPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + +YK T++Y+ + +  + W D  I I WP L   + S+SEKD
Sbjct: 126 DTVQFVYKGTNYYAPQSERSIIWNDPEIRIDWPALSDCVLSLSEKD 171


>gi|239503785|ref|ZP_04663095.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Acinetobacter
           baumannii AB900]
          Length = 188

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 114/171 (66%), Gaps = 8/171 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKL----LKELGLQDV--FVQDNHSFSFDCGTIRGL 56
           I  + IL+ + F D RGWF ++++ K     L E GL D+  FVQDNHS S   G +RGL
Sbjct: 8   IKGLLILEPKVFGDDRGWFMESFNQKAFEQALHERGL-DIPQFVQDNHSLS-QKGVLRGL 65

Query: 57  HFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGF 116
           H+Q  PYAQ KLVR + G+ +D+AVDIR++SPT+G WV +E++  N  Q +IP GFAHGF
Sbjct: 66  HYQLNPYAQGKLVRVVQGKAWDVAVDIRKSSPTFGQWVGVELTGENHKQFWIPAGFAHGF 125

Query: 117 MTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           + LE NT+ +YK T++Y+ E +  + W D SI I WPL +     VS+KD+
Sbjct: 126 VALEDNTQFLYKTTNYYNKESEGAIVWNDPSIAIDWPLSNINQVLVSDKDK 176


>gi|212211866|ref|YP_002302802.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii CbuG_Q212]
 gi|212010276|gb|ACJ17657.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coxiella burnetii CbuG_Q212]
          Length = 189

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++K + F D RG+F +T+     +  G+   F+QDNHS S   G +RGLH+Q 
Sbjct: 8   MPIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVLRGLHYQL 67

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR + G++FD+AVD+RR SPT+G WVS E+ + N   ++IP GFAHG + LE
Sbjct: 68  DPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELCSTNNHMLWIPPGFAHGILVLE 127

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            NT ++YK T  Y  E +  + W D  I+I WP+ + +L  +SEKD    FL + +   +
Sbjct: 128 ENTHLLYKCTAEYVPESERYIRWDDPDINIKWPIKNNLL--LSEKDAAGVFLQRAEINAQ 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YHG 188


>gi|168259602|ref|ZP_02681575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168466248|ref|ZP_02700118.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194442370|ref|YP_002041364.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194401033|gb|ACF61255.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|195631440|gb|EDX50000.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|205351188|gb|EDZ37819.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 182

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  ++L G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEKLIGRKITFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ANAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLDQ 177


>gi|160896725|ref|YP_001562307.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Delftia acidovorans SPH-1]
 gi|160362309|gb|ABX33922.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Delftia acidovorans SPH-1]
          Length = 182

 Score =  164 bits (414), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 113/171 (66%), Gaps = 3/171 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V +++ + F D RG+F ++++ +   +  G    FVQDNHS S   G +RGLH+Q P
Sbjct: 8   IPEVMLIEPKVFGDDRGFFLESFNQQAFNQATGTDHQFVQDNHSRS-KKGVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVR + G +FD+AVDIR+ SPT+G WV  E++ +N  Q+++P GFAHGFM L  
Sbjct: 67  PHAQGKLVRVVRGAVFDVAVDIRKGSPTFGQWVGAELTEDNHRQLWVPPGFAHGFMVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
           + + +YK T FY+ + D G+AW D +I + WP LD  L S+S+KD   P L
Sbjct: 127 SADFLYKATAFYAPQADRGIAWDDPAIGVQWPQLDVEL-SLSDKDLKQPLL 176


>gi|308187468|ref|YP_003931599.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pantoea vagans C9-1]
 gi|308057978|gb|ADO10150.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pantoea vagans C9-1]
          Length = 181

 Score =  164 bits (414), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 111/167 (66%), Gaps = 5/167 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLL-KELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V+I +   F D RG+F +++S K     +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   KIPDVKIFEPAVFGDERGFFFESFSQKKFDNAVGRHVEFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC+AG +FD+AVDIR+ SP +G WV +E+S+ N  Q++IP GFAHGF+TL 
Sbjct: 66  NPFAQGKLVRCVAGAVFDVAVDIRKQSPFFGQWVGVELSSENKRQLWIPEGFAHGFLTLI 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            NTE +YK T+FYS E +  + W D  I+I WP  + +L   SEKD+
Sbjct: 126 DNTEFVYKTTNFYSKESERSIIWNDPLINIEWPEKEVLL---SEKDK 169


>gi|228912334|ref|ZP_04076029.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           200]
 gi|228847317|gb|EEM92276.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis IBL
           200]
          Length = 194

 Score =  164 bits (414), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 111/179 (62%), Gaps = 3/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++  K  D RG+F +T + K  + L LQ  FVQDN S S   GTIRGLH+Q  P
Sbjct: 14  LDGVFIIELDKCSDKRGYFIETCNKKKFELLDLQGDFVQDNQSLSVHTGTIRGLHYQLNP 73

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ K+V CI+G I+D+ VDIR+ SPTYG W    +S  N   + +P GFAHGF T E N
Sbjct: 74  KAQMKVVSCISGSIYDVVVDIRKGSPTYGQWFGTILSEYNNRLLTVPKGFAHGFCTTEPN 133

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           T V YKV ++YS  H+ G+ W D++I I WP   T  P +SEKD+ LP L   +  F Y
Sbjct: 134 TIVQYKVDEYYSPNHEGGILWNDETIGIFWP---TNQPILSEKDKKLPRLKDTNVNFVY 189


>gi|324114029|gb|EGC08002.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia fergusonii B253]
          Length = 178

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 115/170 (67%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFITLSNIAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPFLN 173
            IYK T FY+   +  +AW D  ++I W +    LP VS+KD + LPF N
Sbjct: 130 FIYKTTQFYNPSFERVIAWDDPVLNINWNIKQ--LPFVSKKDMKGLPFSN 177


>gi|96669|pir||S23343 hypothetical protein 7.0 - Salmonella choleraesuis
 gi|46986|emb|CAA43075.1| rmlC [Salmonella enterica]
          Length = 176

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFSDERGFFMESFNQKVFEEAVGRKIEFVQDNHSKS-TKGVLRGLHYQVE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRCIAG +FD+AVDIR +S T+G WV + IS+ N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCIAGEVFDVAVDIRNDSETFGKWVGVNISSENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL 159
             E +YK +++YS EH+ G+ W D  I+ITW +   IL
Sbjct: 127 EAEFVYKTSNYYSGEHERGIIWNDPDINITWGIDSPIL 164


>gi|182416967|ref|ZP_02948348.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium butyricum 5521]
 gi|237666125|ref|ZP_04526112.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182379143|gb|EDT76645.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium butyricum 5521]
 gi|237658215|gb|EEP55768.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 183

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 115/180 (63%), Gaps = 5/180 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++ + F D RGWF +TYS+    E+     FVQDN S+S   G +RG+HFQ   
Sbjct: 8   LDGVYIVEPQVFGDERGWFMETYSAIKTPEIACN--FVQDNQSYSKGKGILRGIHFQNGE 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLVRC+ G + D+AVD+R+ SPTY  WV++E+SA N  Q++IP GF HGF+TL  +
Sbjct: 66  HAQAKLVRCVKGAVLDVAVDLRKGSPTYKKWVAVELSAENKKQLFIPRGFGHGFVTLSDD 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
            E +YK  ++Y+ E+D  + + D  I + W + + IL   SEKD+  P L   D  F Y+
Sbjct: 126 VEFVYKTDNYYNYENDRSIKFDDPEIGVEWGIKNPIL---SEKDKKAPLLIDSDCTFVYE 182


>gi|224540703|ref|ZP_03681242.1| hypothetical protein BACCELL_05617 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224517670|gb|EEF86775.1| hypothetical protein BACCELL_05617 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 190

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 116/182 (63%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  + I++ R F+D RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   NVEGLVIIEPRLFKDERGYFFESFSQREFEEKVHKVNFVQDNESMS-SYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + GR+ D+AVDIR+ SPTYG  V++E+S +N LQ +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVVKGRVLDVAVDIRKGSPTYGEHVAVELSEDNHLQFFIPKGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  ++Y+ + D G++  D+ I I W  P    IL   SEKD   P L   +SPF
Sbjct: 126 VAVFQYKCDNYYAPQADGGISILDEGIGIDWKIPTDKAIL---SEKDTKHPLLRDFESPF 182

Query: 180 EY 181
           EY
Sbjct: 183 EY 184


>gi|82543416|ref|YP_407363.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella boydii Sb227]
 gi|16611726|gb|AAL27313.1|AF402312_5 dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella boydii]
 gi|81244827|gb|ABB65535.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella boydii Sb227]
 gi|167410112|gb|ABZ79716.1| RmlC [Escherichia coli]
 gi|332097110|gb|EGJ02093.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella boydii 3594-74]
          Length = 189

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 117/183 (63%), Gaps = 3/183 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I+ V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EISDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC  G +FD+AVDIR++SPT+G WV + +SA N  Q++IP G AHGF+ L 
Sbjct: 66  EPYAQGKLVRCAVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGLAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              E +YK T++Y  E D G+ W D  ID+ WP L    P +S KD+      ++ +  +
Sbjct: 126 ETAEFLYKTTNYYHPESDRGIIWDDPDIDVKWP-LSIHKPILSIKDEKQKMFKEMIALEK 184

Query: 181 YDG 183
           ++G
Sbjct: 185 WNG 187


>gi|260890572|ref|ZP_05901835.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia hofstadii F0254]
 gi|260859814|gb|EEX74314.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia hofstadii F0254]
          Length = 190

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F D RG+F +TY+ K  +ELGL   FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IKDLVIIEPKVFGDERGFFMETYNQKSFEELGLTMNFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G ++D+AVD+R+ S T+G W ++++SA N L  Y+P GFAHGF+TLE  
Sbjct: 69  HTQGKLVRVIKGSVYDVAVDLRKGSETFGKWYAVKLSAENKLMFYVPEGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD-TILP---SVSEKDQ 167
           TE +Y+ TD Y+ E+DSG+ W DK+++I W   +  I P   ++SEKD+
Sbjct: 129 TEFVYRCTDLYAPEYDSGLLWSDKTLNIDWKFEEFEINPNELTISEKDK 177


>gi|114799033|ref|YP_759507.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hyphomonas neptunium ATCC
           15444]
 gi|114739207|gb|ABI77332.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hyphomonas neptunium ATCC
           15444]
          Length = 193

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/162 (48%), Positives = 108/162 (66%), Gaps = 3/162 (1%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +  D RGWFS+TY+       G+   FVQDN S S   GT+RGLHFQ+PP+ Q KLVRC+
Sbjct: 19  RHTDGRGWFSETYNRSAFFAAGIDFEFVQDNQSRSEKAGTVRGLHFQKPPHEQVKLVRCL 78

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            GRI D+ VDIR  SP +G + ++E+SA NG Q+ IP GFAHGF +L+   E+ YKV+  
Sbjct: 79  QGRILDLVVDIRPGSPRFGKFTAVELSAINGRQLLIPAGFAHGFCSLDDGCEIYYKVSAH 138

Query: 133 YSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLN 173
           Y+ + D+GVA+ D  I I WP   D+++  +S+KD+ LP L 
Sbjct: 139 YAPQSDAGVAFDDPEIGIHWPFPTDSLI--LSDKDRRLPALK 178


>gi|16803122|ref|NP_464607.1| hypothetical protein lmo1082 [Listeria monocytogenes EGD-e]
 gi|47094940|ref|ZP_00232553.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes str.
           1/2a F6854]
 gi|224500276|ref|ZP_03668625.1| hypothetical protein LmonF1_11619 [Listeria monocytogenes Finland
           1988]
 gi|224502604|ref|ZP_03670911.1| hypothetical protein LmonFR_08794 [Listeria monocytogenes FSL
           R2-561]
 gi|254823648|ref|ZP_05228649.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           J1-194]
 gi|254828460|ref|ZP_05233147.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           N3-165]
 gi|254830148|ref|ZP_05234803.1| hypothetical protein Lmon1_02265 [Listeria monocytogenes 10403S]
 gi|254898744|ref|ZP_05258668.1| hypothetical protein LmonJ_02975 [Listeria monocytogenes J0161]
 gi|254911767|ref|ZP_05261779.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes J2818]
 gi|254936093|ref|ZP_05267790.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes F6900]
 gi|255521991|ref|ZP_05389228.1| hypothetical protein LmonocFSL_12347 [Listeria monocytogenes FSL
           J1-175]
 gi|284801414|ref|YP_003413279.1| hypothetical protein LM5578_1165 [Listeria monocytogenes 08-5578]
 gi|284994556|ref|YP_003416324.1| hypothetical protein LM5923_1119 [Listeria monocytogenes 08-5923]
 gi|16410484|emb|CAC99160.1| lmo1082 [Listeria monocytogenes EGD-e]
 gi|47016558|gb|EAL07478.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes str.
           1/2a F6854]
 gi|258600856|gb|EEW14181.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           N3-165]
 gi|258608683|gb|EEW21291.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes F6900]
 gi|284056976|gb|ADB67917.1| hypothetical protein LM5578_1165 [Listeria monocytogenes 08-5578]
 gi|284060023|gb|ADB70962.1| hypothetical protein LM5923_1119 [Listeria monocytogenes 08-5923]
 gi|293589719|gb|EFF98053.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes J2818]
 gi|293592871|gb|EFG00632.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria monocytogenes FSL
           J1-194]
          Length = 186

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 109/174 (62%), Gaps = 3/174 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++K + F D RG+F ++Y+ K   E G+   F+QDNHS S + G +RG+H+Q  P AQ
Sbjct: 11  VKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRGMHYQTNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R   G I+D+ VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF T+  N  V
Sbjct: 71  TKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHGFCTITENVNV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +YKV   YS E+D+G+A+ D  ++ITWP    IL   S+KD   P L   ++ F
Sbjct: 131 LYKVDQLYSPENDAGIAYDDPDLNITWPTDKLIL---SDKDTKHPRLKDAENNF 181


>gi|168229416|ref|ZP_02654474.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194469870|ref|ZP_03075854.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194456234|gb|EDX45073.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205335685|gb|EDZ22449.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 182

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (64%), Gaps = 4/173 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  ++L G +  FVQDNHS S     +RGLHFQR 
Sbjct: 8   IPDVLILEPKVFGDERGFFFESYNQQTFEKLIGRKITFVQDNHSKS-KKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 67  ANAQGKLVRCAIGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 YAEFLYKATNYYSPSSEGSILWNDETIGIEWPF--SQLPELSAKDAAAPLLHQ 177


>gi|317153812|ref|YP_004121860.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944063|gb|ADU63114.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 190

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 114/176 (64%), Gaps = 1/176 (0%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+ R F+D RG+F ++YS +    +G+   FVQDNH++S D   +RG HFQ PP+AQAK
Sbjct: 13  VLEPRVFQDERGFFLESYSRETFSRVGIDCEFVQDNHAYSRDVCVLRGFHFQLPPHAQAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV    G + D+ VD+R+ SPT+G    + +SA N  +++IP GF H ++T+  +TE +Y
Sbjct: 73  LVWVTRGAVLDVVVDLRKGSPTFGKCQHVILSAANFKRMFIPRGFGHAYVTIMPDTEFLY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           KV   Y  +H+ G+AW D  I   W P LD  +P +SEKD+ L FL + DSPF ++
Sbjct: 133 KVDAPYRPDHECGLAWNDPDIGFDWSPALDGRMPVLSEKDRRLGFLAEFDSPFTHE 188


>gi|218660783|ref|ZP_03516713.1| dTDP-4-dehydrorhamnose 3,5-epimerase protein [Rhizobium etli
           IE4771]
          Length = 156

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 96/138 (69%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +F D RG+FS+ +     +E      FVQDN S S   GT+RGLHFQ PP+AQ KLVRC+
Sbjct: 18  RFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRGLHFQIPPFAQGKLVRCL 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
           AGRI D+ VDIR  SP++G W+S E+S + G Q++IP GFAHGF T+E N+ + YKVT  
Sbjct: 78  AGRIMDVVVDIRVGSPSFGKWLSQELSPDTGKQLWIPPGFAHGFATIEPNSVISYKVTAP 137

Query: 133 YSVEHDSGVAWQDKSIDI 150
           YS +HD G+AW D +I I
Sbjct: 138 YSPQHDRGIAWNDPAIGI 155


>gi|168481295|gb|ACA24785.1| RmlC [Shigella dysenteriae]
          Length = 183

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 117/174 (67%), Gaps = 5/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S  C G +RGLH+Q 
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS--CKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              E +YK T++Y+  ++  + W DK + I WP L T+   +S+KD   P L++
Sbjct: 126 ETAEFVYKTTNYYAPGYEGSIIWNDKILSIDWPEL-TLEYILSDKDLKAPILSE 178


>gi|325276928|ref|ZP_08142615.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas sp. TJI-51]
 gi|324097943|gb|EGB96102.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas sp. TJI-51]
          Length = 182

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 110/169 (65%), Gaps = 4/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           ++I  V +   + F D RG+F ++Y++++  E+ GLQ  FVQDNHS S   G +RGLH+Q
Sbjct: 6   LDIPEVVLFTPKVFGDDRGFFYESYNARVFTEVTGLQPDFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
             P+AQ KLVR I G +FD+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGF+TL
Sbjct: 65  LAPHAQGKLVRVIQGEVFDVAVDIRRSSPTFGKWVGAVLSAENKQQLWIPAGFAHGFVTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDFYS + +  +AW D  I I W       P +S KDQ 
Sbjct: 125 SETAEFVYKTTDFYSAKSERCIAWDDPQIAIDWRFDGQ--PQLSGKDQQ 171


>gi|199599660|ref|ZP_03213036.1| dTDP-4-dehydrorhamnose 3,5-epimerase related enzyme [Lactobacillus
           rhamnosus HN001]
 gi|258508993|ref|YP_003171744.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
 gi|199589448|gb|EDY97578.1| dTDP-4-dehydrorhamnose 3,5-epimerase related enzyme [Lactobacillus
           rhamnosus HN001]
 gi|257148920|emb|CAR87893.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
 gi|259650286|dbj|BAI42448.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
          Length = 190

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTREKFVEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 133 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSTAHL-IMSEKDQHHPQLKDAENNFVY 187


>gi|26988513|ref|NP_743938.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida KT2440]
 gi|24983280|gb|AAN67402.1|AE016367_2 dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida KT2440]
          Length = 182

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 116/168 (69%), Gaps = 4/168 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           ++I  V +   + F D RG+F +++++++  E+ GLQ  FVQDNHS S   G +RGLH+Q
Sbjct: 6   LDIPEVVLFTPKVFGDERGFFYESFNARVFSEVTGLQPDFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
             P+AQ KLVR + G +FD+AVDIRR+S T+G WV   +SA N  Q++IP GFAHGF+TL
Sbjct: 65  LAPHAQGKLVRVVQGEVFDVAVDIRRSSTTFGKWVGAVLSAENKNQLWIPPGFAHGFVTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
               E +YK TDFYS + +  +AW D ++ I WP +D++ PS+S KDQ
Sbjct: 125 SETAEFLYKTTDFYSPQCERCIAWNDPAVGIEWP-IDSV-PSLSGKDQ 170


>gi|241761596|ref|ZP_04759683.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373904|gb|EER63437.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 183

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 112/179 (62%), Gaps = 1/179 (0%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++   K+ DSRG+FS+TY+   +K++G+   FVQDN S S + G +RGLH Q 
Sbjct: 6   LSIPEVIVIAPPKYIDSRGFFSETYNENSMKKMGIDTPFVQDNQSLSRNKGVVRGLHCQI 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PY Q KLVRC  G I+D+AVD R  SPTYG WV+ EIS  N  QI+IP GF HGF+TL 
Sbjct: 66  SPYIQGKLVRCPKGAIWDVAVDARFGSPTYGKWVAAEISEENWSQIWIPPGFLHGFVTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            NTEV YK T FY+   +  V W    ++I WP+    +  +SEKD+  P  ++    F
Sbjct: 126 ENTEVQYKCTSFYNKASERAVIWNCHRLNIPWPINHAEI-LLSEKDKTAPSFDETKKWF 183


>gi|239906435|ref|YP_002953176.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio magneticus
           RS-1]
 gi|239796301|dbj|BAH75290.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio magneticus
           RS-1]
          Length = 185

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (60%), Gaps = 8/187 (4%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M ++P  I     +K   F D RG+F +TYS +   + GL   FVQDNH+ S   G +RG
Sbjct: 1   MEVSPTGIPGLVVIKPNVFGDHRGFFLETYSREAYAKAGLDYDFVQDNHARSGPKGVLRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQ PP  QAKLV    G ++D+ VD+R  SPTY  W  +E+SA+N L+  +P GFAHG
Sbjct: 61  LHFQLPPATQAKLVWVTRGAVYDVVVDLRVGSPTYKKWYGIELSADNFLRFMVPRGFAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           ++TL  + E +YKV   Y+ + D+G+AW D  I I WP+ D +L   S+KD   P L  +
Sbjct: 121 YVTLTEDAEFMYKVDAPYAPDLDAGIAWDDPDIGINWPVTDPVL---SQKDAVQPRLAAL 177

Query: 176 DSPFEYD 182
            SPF Y+
Sbjct: 178 GSPFVYE 184


>gi|120598288|ref|YP_962862.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sp. W3-18-1]
 gi|120558381|gb|ABM24308.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sp. W3-18-1]
          Length = 182

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 116/176 (65%), Gaps = 3/176 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V+I++ R F D RG+F ++++ +  +  +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   KIPDVKIIEPRVFGDDRGFFFESFNQQQFEAAIGYPVNFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ Q+KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 66  APHVQSKLVRCVVGEVFDVAVDIRQSSPTFGQWVGVHLSAENKRQLWIPEGFAHGFVTLR 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              E +YK T++Y    D G+ W D+ + + WP+   IL ++S+KD+  P   + +
Sbjct: 126 ETAEFLYKTTNYYCAASDRGIQWNDEKLAVAWPIEGLIL-TLSDKDKRQPIFEKAE 180


>gi|150004940|ref|YP_001299684.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus ATCC
           8482]
 gi|294775787|ref|ZP_06741289.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus PC510]
 gi|149933364|gb|ABR40062.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus ATCC
           8482]
 gi|294450373|gb|EFG18871.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus PC510]
          Length = 190

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 114/182 (62%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V +++ R F+D RG+F +++S +   E  +   FVQDN S S   G +RGLHFQ+ 
Sbjct: 7   GIEGVVVIEPRIFKDERGYFFESFSQREFNEKVMPVNFVQDNESMS-SYGVMRGLHFQQM 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++  N LQ +IP GFAHGF  L  
Sbjct: 66  PYTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELTEENHLQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ + D G+  +D+S+ I W  P+ + IL   SEKD   P L   DSPF
Sbjct: 126 TAVFQYKCDNFYAPQADGGIQLRDESLGIDWKIPVAEAIL---SEKDLKHPLLKDYDSPF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|258540230|ref|YP_003174729.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus Lc
           705]
 gi|56684475|gb|AAW22444.1| RmlC [Lactobacillus rhamnosus]
 gi|257151906|emb|CAR90878.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus Lc
           705]
          Length = 190

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTREKFVEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGHWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 133 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSTAHL-IMSEKDQHHPQLKDAENNFIY 187


>gi|225590484|gb|ACN94858.1| RmlC [Lactobacillus rhamnosus GG]
          Length = 199

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 22  VKLVETDVFGDNRGFFTETYTREKFIEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 81

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 82  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 141

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 142 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSKAHL-IMSEKDQHHPQLKDAENNFIY 196


>gi|325571038|ref|ZP_08146610.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           ATCC 12755]
 gi|325156123|gb|EGC68309.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           ATCC 12755]
          Length = 193

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 111/182 (60%), Gaps = 3/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V IL+   F D RG+F+++YS    +E G+   FVQDNHS S + G +RGLHFQ+ 
Sbjct: 10  KLTDVLILEPAVFGDHRGFFTESYSQADFQEAGITQTFVQDNHSLSVEAGVLRGLHFQKG 69

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGFMTL  
Sbjct: 70  TAAQTKLIRVVTGAVLDVIVDIRKGSPTYGEWEGYILSESNQRQLLVPKGFAHGFMTLTS 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID--SPF 179
           N   +YK  ++Y  + D+G+A+ D  + I WP+       +SEKDQ+ P L   +  +PF
Sbjct: 130 NVNFLYKCDNYYDAQADAGIAFDDPDLAIDWPIAKE-KAILSEKDQHHPTLKAFEEQNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 IY 190


>gi|56684495|gb|AAW22462.1| RmlC [Lactobacillus rhamnosus]
 gi|56684515|gb|AAW22480.1| RmlC [Lactobacillus rhamnosus]
          Length = 190

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTREKFVEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 133 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSTAHL-IMSEKDQHHPQLKDAENNFIY 187


>gi|187880505|gb|ACD37023.1| RmlC [Shigella boydii]
          Length = 179

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 114/175 (65%), Gaps = 4/175 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EIPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              E +YK T +Y  E + G+ W D++I + WPL   ++  +S KD   P  N I
Sbjct: 126 ETAEFVYKTTQYYHPECERGIRWDDENIGVDWPLSTDLI--LSFKDTKHPKFNGI 178


>gi|254993500|ref|ZP_05275690.1| hypothetical protein LmonocytoFSL_11287 [Listeria monocytogenes FSL
           J2-064]
          Length = 187

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 107/170 (62%), Gaps = 3/170 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++K + F D RG+F ++Y+ K   E G+   F+QDNHS S + G +RG+H+Q  P AQ
Sbjct: 11  VKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRGMHYQTNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R   G I+D+ VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF T+  N  V
Sbjct: 71  TKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHGFCTITENVNV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           +YKV   YS E+D+G+A+ D  ++ITWP    IL   S+KD   P L  +
Sbjct: 131 LYKVDQLYSPENDAGIAYDDPDLNITWPTDKLIL---SDKDTKHPRLKXL 177


>gi|258509034|ref|YP_003171785.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
 gi|257148961|emb|CAR87934.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
 gi|259650325|dbj|BAI42487.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus rhamnosus GG]
          Length = 190

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTREKFIEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 133 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSTAHL-IMSEKDQHHPQLKDAENNFIY 187


>gi|257126937|ref|YP_003165051.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia buccalis
           C-1013-b]
 gi|257050876|gb|ACV40060.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptotrichia buccalis
           C-1013-b]
          Length = 190

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F D RG+F +TY+ K  +ELGL   FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IKDLVIIEPKVFGDERGFFMETYNQKSFEELGLTMSFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G ++D+AVD+R+ S T+G W ++++SA N L  Y+P GFAHGF+TLE  
Sbjct: 69  HTQGKLVRVIKGSVYDVAVDLRKGSDTFGKWYAIKLSAENKLMFYVPEGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILP----SVSEKDQ 167
           TE +Y+ TD Y+ E+DSG+ W D++I+I W   +  +     ++SEKD+
Sbjct: 129 TEFVYRCTDLYAPEYDSGLLWNDETINIDWKFEEFGINHDELTISEKDK 177


>gi|187935603|ref|YP_001887438.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum B str.
           Eklund 17B]
 gi|187723756|gb|ACD24977.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum B str.
           Eklund 17B]
          Length = 179

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 113/177 (63%), Gaps = 5/177 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++ + F D RGWF +TYS     E+     F+QDN S+S + G +RG+HFQ   
Sbjct: 8   LDGVYIVEPQVFGDERGWFMETYSKIKTPEIACD--FIQDNQSYSKEKGILRGIHFQNGK 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAKLVRC+ G + D+AVD+R+NSPTY  WV++E+SA N  Q++IP GF HGF+TL  +
Sbjct: 66  HAQAKLVRCVRGAVLDVAVDLRKNSPTYKQWVAVELSAENKKQLFIPRGFGHGFVTLTDD 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            E +YK  ++Y+ E D  + + D  I + W + + IL   SEKD+  P L   D  F
Sbjct: 126 VEFVYKTDNYYNHESDRSIRFNDPEIGVEWGIKNPIL---SEKDKKAPLLKDSDCIF 179


>gi|254430167|ref|ZP_05043870.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanobium sp. PCC 7001]
 gi|197624620|gb|EDY37179.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanobium sp. PCC 7001]
          Length = 191

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 106/173 (61%), Gaps = 3/173 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L  R F D RG+F ++++            FVQDNHS S   G +RGLH+Q PP+ Q
Sbjct: 17  VLLLTPRVFGDDRGFFFESWNQNAFNAAAGPTAFVQDNHSRSVQ-GVLRGLHYQLPPHPQ 75

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRC+ G IFD+AVDIR +SPT+G W  + +SA N  Q+++P G+AHGF+TL    EV
Sbjct: 76  GKLVRCLVGEIFDVAVDIRPSSPTFGQWGGVRLSAANKQQLWVPAGYAHGFLTLSPEAEV 135

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQID 176
           +YK TDF+S E + G+ W D  I I WP   L    P +S KD   P L + D
Sbjct: 136 LYKTTDFWSKECERGIRWDDPQIGIAWPQEGLPDGQPLLSAKDAVAPALAEAD 188


>gi|242278516|ref|YP_002990645.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio salexigens DSM
           2638]
 gi|242121410|gb|ACS79106.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio salexigens DSM
           2638]
          Length = 183

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 110/174 (63%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ + F D RG+F ++++  +  E GL   FVQDNH++S   G IRGLH Q PP+AQAK
Sbjct: 13  VIEPKVFRDRRGFFLESFNKNVFAENGLPTDFVQDNHAYSSGLGVIRGLHLQMPPHAQAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV    G + D+ VD+R+ SPTY     +E+SA N L+++IP GFAHG+ TL    E +Y
Sbjct: 73  LVWVTRGAVNDVVVDLRKGSPTYRRSFKIELSAENFLRLFIPKGFAHGYETLTEENEFMY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KV   Y+   ++G+ W D  +DI W    T  P +S+KD  LP L Q DSPFE+
Sbjct: 133 KVDSGYAPGSEAGIRWDDPELDIDW---KTKNPVLSDKDLELPLLAQFDSPFEF 183


>gi|148252643|ref|YP_001237228.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bradyrhizobium sp. BTAi1]
 gi|146404816|gb|ABQ33322.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bradyrhizobium sp. BTAi1]
          Length = 191

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 113/170 (66%), Gaps = 3/170 (1%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           K  D+RG+FS+ Y  ++    GL   FVQ+NH FS   G +RGLHFQRPP AQ KLVRCI
Sbjct: 18  KHGDARGFFSEVYRREIASAAGLPVDFVQENHVFSAQRGVLRGLHFQRPPRAQGKLVRCI 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G I D+AVDIR  SPT+G  V++E+S+ N  Q+++P GFAHG+  LE   EV+YKVTD+
Sbjct: 78  RGAILDVAVDIRTGSPTFGRHVAVELSSANWTQLWVPEGFAHGYAVLEAPCEVLYKVTDY 137

Query: 133 YSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
           ++   + G+AW D  + I W L  D ++  +S+KD+  P L+ +   F++
Sbjct: 138 WAPSSELGLAWDDPDLGIDWRLGRDEVI--LSDKDRVHPRLSGLAPVFQF 185


>gi|312868786|ref|ZP_07728977.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus oris
           PB013-T2-3]
 gi|311095685|gb|EFQ53938.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus oris
           PB013-T2-3]
          Length = 191

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 111/177 (62%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
            +I++T  F D RG+F++TY+    +E G+   F QDN S S + G +RG+H+Q  PY+Q
Sbjct: 13  AKIVETDVFGDHRGFFTETYTKNKFEEAGVNVEFTQDNQSLSVEPGVLRGMHYQLAPYSQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G I+D+ VDIR+ SP YG W    +S  N  Q+ +P GFAHGF+TL  N  V
Sbjct: 73  TKLLRAVTGAIYDVIVDIRKGSPAYGKWEGFILSEYNHRQLLVPKGFAHGFVTLTPNVNV 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV  +Y+ E D G+A+ D  +DI WP+ +D ++  +SEKDQ+ P     +  F Y
Sbjct: 133 AYKVDGYYAPEADRGIAFDDPDLDIKWPMPVDHLI--LSEKDQHHPAFKDAEINFTY 187


>gi|168481379|gb|ACA24862.1| RmlC [Shigella dysenteriae]
 gi|168481394|gb|ACA24876.1| RmlC [Escherichia coli]
          Length = 180

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 113/166 (68%), Gaps = 3/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   EIPDVLIFEPKIFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFITLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP-LLDTILPSVSEK 165
              E +YK TDFYS +H+  + + D+SI I WP   D +L S  +K
Sbjct: 126 NIAEFLYKTTDFYSPKHEVCIRYDDESIGIQWPKATDKMLISSKDK 171


>gi|13650067|gb|AAK37550.1|AF349575_1 putative dTDP-rhamnose-3,5-epimerase [Azospirillum brasilense]
 gi|46241701|gb|AAS83086.1| putative dTDP-rhamnose-3,5-epimerase [Azospirillum brasilense]
          Length = 187

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 114/175 (65%), Gaps = 2/175 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           VR++  ++F D+RG+F +T++ +     GL+  +VQDN S S   GT+RG+H+Q  P+AQ
Sbjct: 11  VRLVVPKRFGDARGYFVETWNEQAFALNGLERRWVQDNQSLSATPGTVRGMHYQLAPFAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R +AGRI D+ VDIRR SPT+G  V++E++A+   Q++IP GFAHGF TLE NT V
Sbjct: 71  TKLIRVLAGRILDVVVDIRRGSPTFGRHVAVELTADGLEQLFIPAGFAHGFCTLEPNTAV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            YKV   YS E +  + W D ++ I WP +     SVS+KD   P L +    F+
Sbjct: 131 AYKVDAPYSRECERAILWNDPALGIDWPAMAGA--SVSDKDAVAPRLAKATDLFD 183


>gi|283785858|ref|YP_003365723.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Citrobacter rodentium ICC168]
 gi|282949312|emb|CBG88923.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Citrobacter rodentium ICC168]
          Length = 182

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 113/174 (64%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAIGRKVDFVQDNHSKS-SKGVLRGLHYQLA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQAKLVRCIAG +FD+AVDIR +SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQAKLVRCIAGEVFDVAVDIRESSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E +YK T++Y  E D G+ W D  I I W   +     +S+KD+  P +  +
Sbjct: 127 TAEFVYKTTNYYHPECDRGIRWDDAYIGIKWG--NDYNVKLSDKDKKNPTMKDV 178


>gi|168481307|gb|ACA24796.1| RmlC [Escherichia coli]
          Length = 183

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 115/173 (66%), Gaps = 3/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSCK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKWSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T++Y+  ++  + W DK + I WP L T+   +S+KD   P L++
Sbjct: 127 TAEFVYKTTNYYAPGYEGSIIWNDKILSIDWPEL-TLEYILSDKDLKAPILSE 178


>gi|325105319|ref|YP_004274973.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter saltans DSM 12145]
 gi|324974167|gb|ADY53151.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter saltans DSM 12145]
          Length = 182

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 114/177 (64%), Gaps = 2/177 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + ++D RG+F ++Y+ KL KE G+   FVQDN S+S   GT+RGLH Q  P
Sbjct: 8   IKGLIVIEPKIWKDDRGYFYESYNEKLFKEAGIDTSFVQDNQSYS-QKGTLRGLHAQANP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR I G++ D+AVDIR++SPTYG + S+E+S  N    ++P GF HGF+TLE N
Sbjct: 67  FAQGKLVRVIQGKVLDVAVDIRKDSPTYGQYFSVELSGENFKMFWVPPGFLHGFITLEDN 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           T   YKVT  Y    + GV W D  ++I W   DT    +SEKD+ L    + +SPF
Sbjct: 127 TIFSYKVTGLYDKASELGVLWNDPDLNIDWK-FDTRQAILSEKDKQLISFKEFNSPF 182


>gi|15895598|ref|NP_348947.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium acetobutylicum
           ATCC 824]
 gi|15025340|gb|AAK80287.1|AE007734_1 DTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium acetobutylicum
           ATCC 824]
 gi|325509746|gb|ADZ21382.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium acetobutylicum EA
           2018]
          Length = 185

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 108/178 (60%), Gaps = 2/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I+ V I++T  F D+RG+F +TY+ +  KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIDGVYIIETGVFGDNRGYFMETYNYEEFKEAGLDMVFVQDNQSKSRK-GVLRGLHFQKK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R  S TYG WV + +S  N  Q YIP GFAHGF+ L  
Sbjct: 69  -HTQGKLVRVVKGEVFDVAVDLREGSKTYGKWVGVTLSEENKKQFYIPEGFAHGFVVLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
             E  YK TDFY    + G+ W D  + I WP+ D      SEKDQ  P L++    F
Sbjct: 128 EAEFCYKCTDFYDPTSEGGILWNDPEVGIKWPIDDIENLIFSEKDQKWPKLSECGIKF 185


>gi|299532674|ref|ZP_07046062.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni S44]
 gi|298719309|gb|EFI60278.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Comamonas testosteroni S44]
          Length = 183

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (62%), Gaps = 3/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  +++ K     D RG F +++   L  +  G    F+QDNHS S   G +RGLH+Q P
Sbjct: 8   IPEIKLFKPTIHRDGRGLFVESFRQDLFNQATGTNYEFIQDNHSRS-SKGVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVR I+G +FD+AVDIRR+S T+G WV  E+SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PHAQGKLVRVISGAVFDVAVDIRRSSLTFGKWVGAELSAENHRQLWIPPGFAHGFVVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             +++YK T +Y+ E D G+ W D  I I WP LD    S+SEKDQ+ P   Q +
Sbjct: 127 TADLVYKATAYYAPESDRGLLWNDPDIAIAWPQLDIDF-SLSEKDQHQPAFTQAE 180


>gi|83859876|ref|ZP_00953396.1| hypothetical protein OA2633_07744 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852235|gb|EAP90089.1| hypothetical protein OA2633_07744 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 186

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 110/182 (60%), Gaps = 3/182 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V+++  ++F D RGWF++T+SS  L  LG    FVQDN S+S   GT+RGLH Q 
Sbjct: 6   LQIPDVKLISPKRFRDDRGWFNETWSSDKLAGLGFVQSFVQDNLSYSSASGTLRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP AQ KLV  + G I+D  VD+R  SPT+G  V +E+  N   Q++IP GF HGF+T  
Sbjct: 66  PPCAQGKLVSVVTGAIWDFVVDVRTGSPTFGQSVRIELDENTPHQLWIPEGFLHGFLTRA 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T V YKVT  YS  HD  +AW D  + + W + D +L   S+KD+  P L   D  F 
Sbjct: 126 PDTRVSYKVTAPYSPAHDRSIAWNDPFLGLAWGVADPVL---SDKDRQAPQLKNSDVHFT 182

Query: 181 YD 182
           Y+
Sbjct: 183 YE 184


>gi|212694335|ref|ZP_03302463.1| hypothetical protein BACDOR_03861 [Bacteroides dorei DSM 17855]
 gi|237727666|ref|ZP_04558147.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D4]
 gi|212662836|gb|EEB23410.1| hypothetical protein BACDOR_03861 [Bacteroides dorei DSM 17855]
 gi|229434522|gb|EEO44599.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides dorei 5_1_36/D4]
          Length = 190

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 114/182 (62%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V +++ R F+D RG+F +++S +   E  +   FVQDN S S   G +RGLHFQ+ 
Sbjct: 7   GIEGVVVIEPRIFKDERGYFFESFSQREFNEKVMPVNFVQDNESMS-SYGVMRGLHFQQM 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++  N LQ +IP GFAHGF  L  
Sbjct: 66  PYTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELTEENHLQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ + D G+  +D+S+ I W  P+ + IL   SEKD   P L   DSPF
Sbjct: 126 IAVFQYKCDNFYAPQADGGIQLRDESLGIDWKIPVAEAIL---SEKDLKHPLLKDYDSPF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|46579112|ref|YP_009920.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603309|ref|YP_967709.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris DP4]
 gi|46448525|gb|AAS95179.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563538|gb|ABM29282.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris DP4]
 gi|311232955|gb|ADP85809.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio vulgaris RCH1]
          Length = 190

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 105/176 (59%), Gaps = 3/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           +R+L  +   D RG+F +TY       L     FVQDNH+ S D G +RGLHFQ PP  Q
Sbjct: 11  LRLLTPQAHRDERGFFLETYRESFFDTLTHGQRFVQDNHARSEDAGVLRGLHFQLPPMTQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLV  + G I+D+AVD+R  SPT+G W    ++A +  +IY+P GFAHG+MTLE  TEV
Sbjct: 71  AKLVWAVQGSIYDVAVDLREGSPTFGRWFGCTLTAASFQRIYVPRGFAHGYMTLEPGTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+   + G+ W D  I ITWP +  IL   S KDQ         +PF +
Sbjct: 131 MYKVDAYYAPALEQGLPWNDPDIGITWPDMTPIL---SAKDQRHGTFRDFRTPFSF 183


>gi|317498846|ref|ZP_07957132.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316893874|gb|EFV16070.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 184

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 107/167 (64%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+   +KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIEGLYVIEPTVFKDERGYFVETYNQNDMKEAGLDMVFVQDNQSMS-TRGVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G++FD+AVD+R +S TYG W  +E+SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -FPQGKLVRVVRGKVFDVAVDLRSDSKTYGKWFGVELSAENMKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+AW D  I + WPL + +   +SEKDQ 
Sbjct: 128 EAEFCYKCTDFYHPGDEGGLAWNDPEIGVEWPLEEGVDLIISEKDQK 174


>gi|289434339|ref|YP_003464211.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289170583|emb|CBH27123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 186

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 109/174 (62%), Gaps = 3/174 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++K + F D RG+F ++Y+ K   + G+   F+QDNHS S + G +RG+H+Q  P AQ
Sbjct: 11  VKLVKPKVFGDHRGFFMESYNEKAFHDAGIDMKFIQDNHSLSVEAGVLRGMHYQTNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R   G I+D+ VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF T+  N  V
Sbjct: 71  TKLIRVGTGAIYDVVVDMRKGSPTYGEWEGFILSEANKHQLLVPQGFAHGFCTITENVNV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +YKV   YS E+D+G+A+ D  ++ITWP    IL   S+KD   P L   ++ F
Sbjct: 131 LYKVDQLYSPENDAGIAYDDPDLNITWPTDKLIL---SDKDTKHPRLKDAENNF 181


>gi|257893558|ref|ZP_05673211.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,408]
 gi|257829937|gb|EEV56544.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,408]
          Length = 197

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 112/181 (61%), Gaps = 3/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   F D RG+F+++YS     E GL+  FVQDNHS S + G +RGLHFQ+  
Sbjct: 15  LTDVKIVEMDVFGDHRGFFTESYSKAKFAEHGLKYDFVQDNHSLSAEAGVLRGLHFQKGE 74

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P G+AHGF+TL  N
Sbjct: 75  AAQTKLIRVVTGAVLDVVVDIRKGSPTYGQWDGFILSEHNHRQLLVPKGYAHGFVTLTPN 134

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS--PFE 180
              +YK  ++Y+ E D G+A+ D  + I WP +D     +SEKD   P L + ++  PF 
Sbjct: 135 VNFLYKCDNYYNAEADGGIAFDDPDLAIDWP-IDPSRAIMSEKDHRHPTLKEFEAENPFV 193

Query: 181 Y 181
           Y
Sbjct: 194 Y 194


>gi|317052620|ref|YP_004113736.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurispirillum indicum
           S5]
 gi|316947704|gb|ADU67180.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurispirillum indicum
           S5]
          Length = 189

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 116/183 (63%), Gaps = 10/183 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIR 54
           M I P +I     L+ R  EDSRG+F +T+    L   LG Q  FVQDN S S  CG +R
Sbjct: 1   MKITPTQIADVLLLEPRVLEDSRGYFMETFRLDALHAALGFQVGFVQDNESCS-RCGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q PP+AQ+KLVR +AG + D+AVDIRR SPT+G  VS E+SA N  QI+IP GFAH
Sbjct: 60  GLHYQLPPFAQSKLVRVVAGCVLDVAVDIRRESPTFGACVSTELSAENKRQIFIPRGFAH 119

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLN 173
           GF+ L     V YKV ++YS + D G+ + D  + I W L  D +L  +S+KD + P L 
Sbjct: 120 GFVVLSEVAVVQYKVDNYYSSKSDRGIVYNDPHLGIDWRLPADQLL--LSDKDSHQPSLK 177

Query: 174 QID 176
           + +
Sbjct: 178 EAE 180


>gi|313633864|gb|EFS00584.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Listeria seeligeri FSL
           N1-067]
          Length = 186

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 109/174 (62%), Gaps = 3/174 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+++K + F D RG+F ++Y+ K   + G+   F+QDNHS S + G +RG+H+Q  P AQ
Sbjct: 11  VKLVKPKVFGDHRGFFMESYNEKAFHDAGIDMKFIQDNHSLSVEAGVLRGMHYQTNPRAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R   G I+D+ VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF T+  N  V
Sbjct: 71  TKLIRVGTGAIYDVVVDMRKGSPTYGEWEGFILSEANKHQLLVPQGFAHGFCTITENVNV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +YKV   YS E+D+G+A+ D  ++ITWP    IL   S+KD   P L   ++ F
Sbjct: 131 LYKVDQLYSPENDAGIAYDDPDLNITWPTDKLIL---SDKDTKHPRLKDAENNF 181


>gi|91211322|ref|YP_541308.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli UTI89]
 gi|300986909|ref|ZP_07177887.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 45-1]
 gi|91072896|gb|ABE07777.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) (dTDP-L-rhamnose synthetase) [Escherichia
           coli UTI89]
 gi|288816226|gb|ADC54948.1| RmlC [Escherichia coli]
 gi|294493064|gb|ADE91820.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli IHE3034]
 gi|300407838|gb|EFJ91376.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 45-1]
 gi|307626418|gb|ADN70722.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli
           UM146]
 gi|315295252|gb|EFU54587.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 153-1]
          Length = 185

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 115/176 (65%), Gaps = 4/176 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++Y+ ++ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESYNQRVFEEAVGRKVEFVQDNHSKS-RKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQAKLVRCI G +FDIAVDIR++SP +G WV + +SA N  Q++IP GFAHGF+ +  
Sbjct: 67  PYAQAKLVRCIEGEVFDIAVDIRKSSPFFGKWVGVTLSAENKRQLWIPEGFAHGFVVISD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             E +YK  ++YS + +  + + DK + I WPL    +  +SEKD N P   +I S
Sbjct: 127 TAEFVYKTNNYYSQQAERSIIFDDKDLGIAWPLNTHYI--LSEKDLNAPTFKKISS 180


>gi|167748151|ref|ZP_02420278.1| hypothetical protein ANACAC_02895 [Anaerostipes caccae DSM 14662]
 gi|317472316|ref|ZP_07931644.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anaerostipes sp. 3_2_56FAA]
 gi|167652143|gb|EDR96272.1| hypothetical protein ANACAC_02895 [Anaerostipes caccae DSM 14662]
 gi|316900273|gb|EFV22259.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anaerostipes sp. 3_2_56FAA]
          Length = 184

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 102/167 (61%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++   F D RG+F +TY+ K  +E GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  EIEGLHIIEPAVFPDERGYFMETYNQKDFEEAGLGMTFVQDNQSMSVK-GVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G++FD+AVD+R++S TYG W  +E+SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -YPQGKLVRVVRGKVFDVAVDLRKDSQTYGKWFGVELSAENKKQFYIPEGFAHGFLVLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  I I WP  +     +SEKDQ 
Sbjct: 128 EAEFCYKCTDFYHPGDEGGIKWDDPDIGIEWPFEEGTELVISEKDQK 174


>gi|191167713|ref|ZP_03029521.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli B7A]
 gi|76366005|gb|ABA42230.1| RmlC [Escherichia coli]
 gi|190902226|gb|EDV61967.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli B7A]
          Length = 185

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKIFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y+   +  +++ D +I I WP L  +   +S KD N
Sbjct: 130 FVYKTTNYYNPSFEKSISYSDPTIKIQWPNLQDMHFKLSNKDLN 173


>gi|16611740|gb|AAL27325.1|AF402313_5 dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella boydii]
          Length = 178

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKIFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++S T+G WV + +SA N  Q++IP GFAHGF+TL    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSTTFGKWVGVNLSAENKRQLWIPEGFAHGFITLSNIAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPFLN 173
            IYK T FY+   +  +AW D  ++I W +    LP VS+KD + LPF N
Sbjct: 130 FIYKTTQFYNPSFERVIAWDDPVLNINWNIKQ--LPFVSKKDMKGLPFRN 177


>gi|301311243|ref|ZP_07217171.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
 gi|300830817|gb|EFK61459.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
          Length = 193

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 118/181 (65%), Gaps = 4/181 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ + F+D+RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQRP
Sbjct: 7   DIEGVVIIEPKVFDDARGYFFESFSQREFEEKVRKINFVQDNESMS-SYGVMRGLHFQRP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E+S +N  Q ++P GFAHGF  L  
Sbjct: 66  PFTQSKLVRCVKGCVLDVAVDIRKGSPTYGKHVAVELSEDNHRQFFVPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  +FY+ + D G+  +D+S+ I W + +D  L  +SEKD   P L   DSPF+
Sbjct: 126 IAVFQYKCDNFYAPQADGGICIKDESLGIDWRIPMDKAL--LSEKDIKHPCLEDFDSPFD 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|293415326|ref|ZP_06657969.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli B185]
 gi|291432974|gb|EFF05953.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli B185]
          Length = 185

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y+   +  +++ D +I I WP L  +   +S KD N
Sbjct: 130 FVYKTTNYYNPSFEKSISYSDPTIKIQWPNLQDMHFKLSNKDLN 173


>gi|69244638|ref|ZP_00602902.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium DO]
 gi|257882964|ref|ZP_05662617.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,502]
 gi|257885215|ref|ZP_05664868.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,501]
 gi|257891454|ref|ZP_05671107.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,410]
 gi|258614493|ref|ZP_05712263.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium DO]
 gi|260560530|ref|ZP_05832704.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium C68]
 gi|261206555|ref|ZP_05921255.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TC 6]
 gi|289565465|ref|ZP_06445914.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium D344SRF]
 gi|293553222|ref|ZP_06673859.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1039]
 gi|293560232|ref|ZP_06676732.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1162]
 gi|293568262|ref|ZP_06679586.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1071]
 gi|294614673|ref|ZP_06694575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1636]
 gi|294619030|ref|ZP_06698525.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1679]
 gi|294620973|ref|ZP_06700172.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium U0317]
 gi|314940009|ref|ZP_07847202.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           TX0133a04]
 gi|314941887|ref|ZP_07848751.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133C]
 gi|314950067|ref|ZP_07853354.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0082]
 gi|314952414|ref|ZP_07855420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133A]
 gi|314993217|ref|ZP_07858597.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133B]
 gi|314997807|ref|ZP_07862719.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           TX0133a01]
 gi|68196229|gb|EAN10658.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium DO]
 gi|257818622|gb|EEV45950.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,502]
 gi|257821067|gb|EEV48201.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,501]
 gi|257827814|gb|EEV54440.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,231,410]
 gi|260073532|gb|EEW61860.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium C68]
 gi|260079265|gb|EEW66956.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TC 6]
 gi|289162794|gb|EFD10645.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium D344SRF]
 gi|291588974|gb|EFF20798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1071]
 gi|291592411|gb|EFF24018.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1636]
 gi|291594691|gb|EFF26073.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1679]
 gi|291599431|gb|EFF30449.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium U0317]
 gi|291602632|gb|EFF32847.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1039]
 gi|291605804|gb|EFF35238.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E1162]
 gi|313588179|gb|EFR67024.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           TX0133a01]
 gi|313592298|gb|EFR71143.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133B]
 gi|313595457|gb|EFR74302.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133A]
 gi|313599312|gb|EFR78157.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0133C]
 gi|313640742|gb|EFS05322.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           TX0133a04]
 gi|313643602|gb|EFS08182.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX0082]
          Length = 190

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 112/182 (61%), Gaps = 3/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V+I++   F D RG+F+++YS     E GL+  FVQDNHS S + G +RGLHFQ+ 
Sbjct: 7   KLTDVKIVEMDVFGDHRGFFTESYSKAKFAEHGLKYDFVQDNHSLSAEAGVLRGLHFQKG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P G+AHGF+TL  
Sbjct: 67  EAAQTKLIRVVTGAVLDVVVDIRKGSPTYGQWDGFILSEHNHRQLLVPKGYAHGFVTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS--PF 179
           N   +YK  ++Y+ E D G+A+ D  + I WP +D     +SEKD   P L + ++  PF
Sbjct: 127 NVNFLYKCDNYYNAEADGGIAFDDPDLAIDWP-IDPSRAIMSEKDHRHPTLKEFEAENPF 185

Query: 180 EY 181
            Y
Sbjct: 186 VY 187


>gi|256017789|ref|ZP_05431654.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella sp. D9]
 gi|332278810|ref|ZP_08391223.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella sp. D9]
 gi|332101162|gb|EGJ04508.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella sp. D9]
          Length = 185

 Score =  160 bits (406), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 115/176 (65%), Gaps = 4/176 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKIFEEAVGRKVEFVQDNHSKS-RKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQAKLVRCI G +FDIAVDIR++SP +G WV + +SA N  Q++IP GFAHGF+ +  
Sbjct: 67  PYAQAKLVRCIEGEVFDIAVDIRKSSPFFGKWVGVTLSAENKRQLWIPEGFAHGFVVISD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             E +YK  ++YS + +  + + DK + I WPL    +  +SEKD N P   +I S
Sbjct: 127 TAEFVYKTNNYYSQQAERSIIFDDKDLGIAWPLNTHYI--LSEKDLNAPTFKKISS 180


>gi|261415186|ref|YP_003248869.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|261371642|gb|ACX74387.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|302326605|gb|ADL25806.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 187

 Score =  160 bits (406), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 109/178 (61%), Gaps = 2/178 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I++   F D+RG+F +TYS +   E G+   FVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGVKIIEPTVFGDARGYFMETYSKRDFAEGGIDVDFVQDNESRS-RKGVLRGLHFQKQN 69

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR I G +FD+AVD+R+NS T+G WV + +SA N  Q YIP GFAHGF+ L   
Sbjct: 70  -PQGKLVRVIEGEVFDVAVDLRKNSKTFGKWVGVTLSAENKKQFYIPEGFAHGFVVLSET 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
              +YK T FY+   + G+ W D +I I WP+ +   P +SEKD   P L  +D  F+
Sbjct: 129 AAFVYKCTRFYAPNDEGGLFWNDPAIGIKWPVGEGFEPLLSEKDTKNPLLKDLDFAFD 186


>gi|329113803|ref|ZP_08242574.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pomorum DM001]
 gi|326696813|gb|EGE48483.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pomorum DM001]
          Length = 190

 Score =  160 bits (406), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 110/185 (59%), Gaps = 5/185 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++   +F D+RG+FS+TY+ + ++E G+ + FVQDN S S   G IRGLH Q 
Sbjct: 6   LAIPDVILITPPRFGDNRGFFSETYNIERMREAGITEPFVQDNQSLSRQKGVIRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC  G I+D+AVD R  SPTYG WV+ E+S  N  Q++IP GF HGF TL 
Sbjct: 66  DPFAQGKLVRCTRGAIWDVAVDARTGSPTYGKWVAAELSEENWSQLWIPPGFLHGFCTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSP 178
            N EV YK T  YS   +  V W    + I WP+   D +L   SEKD   P  +     
Sbjct: 126 ENAEVQYKCTALYSKASERAVIWNSAELGIEWPVKAEDAVL---SEKDLLAPEFSAAKGW 182

Query: 179 FEYDG 183
           F+Y G
Sbjct: 183 FQYTG 187


>gi|255524619|ref|ZP_05391572.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium carboxidivorans
           P7]
 gi|255511643|gb|EET87930.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium carboxidivorans
           P7]
          Length = 181

 Score =  160 bits (406), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 111/175 (63%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V I+    F D RG+F +TY+    K +GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IDGVYIIDVEIFSDKRGYFIETYNYDDFKSVGLDMVFVQDNQSSS-KKGVLRGLHFQKT- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G +FD+AVDIR+NS T+G WV + +S  N  Q YIP GFAHGF+ L   
Sbjct: 69  HPQGKLVRVIKGEVFDVAVDIRKNSKTFGKWVGVTLSEGNKRQFYIPQGFAHGFLVLSDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQI 175
           +E+ YK TDFY  E + G+AW D  I I WP+  +D I+  +S+KD N    ++I
Sbjct: 129 SEICYKCTDFYHSEDEGGIAWDDPEIGIEWPMEGIDEII--LSDKDGNRENFSKI 181


>gi|303238695|ref|ZP_07325228.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetivibrio cellulolyticus
           CD2]
 gi|302593814|gb|EFL63529.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetivibrio cellulolyticus
           CD2]
          Length = 182

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 114/172 (66%), Gaps = 3/172 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++++ F DSRG+F ++Y+    +ELGL   FVQDNHS S   G +RG+HFQ   
Sbjct: 11  IRDLVIIESKVFGDSRGFFMESYNKASFEELGLNMEFVQDNHSKS-KKGVLRGIHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ KLVR I GR++D+AVD+R+ S T+G W ++E++  N    YIP GF H F+T+E +
Sbjct: 69  YAQGKLVRVIKGRVYDVAVDLRKGSETFGKWYAIELTEENKTMFYIPEGFGHAFLTMEDD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           TE  YK T+ Y  E+D+G+ ++DK I I WP +      +SEKD+ LP L +
Sbjct: 129 TEFSYKTTNIYHPEYDAGIIYKDKDIAIDWPNIGCEFI-LSEKDKVLPSLKE 179


>gi|310829413|ref|YP_003961770.1| dTDP-4-dehydrorhamnose 3 [Eubacterium limosum KIST612]
 gi|308741147|gb|ADO38807.1| dTDP-4-dehydrorhamnose 3 [Eubacterium limosum KIST612]
          Length = 186

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 110/182 (60%), Gaps = 7/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++   F D RG+F +TY+ +  ++ GL   F+QDN S S   G +RGLHFQR 
Sbjct: 10  QIEGLVIVQPSVFGDERGYFMETYNKEEFEKQGLNMTFIQDNESKS-KKGVLRGLHFQRK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y+Q KLVRC  G ++D+ VD+R+ SPTYG W  +E+SA N    YIP GFAHGF+ L  
Sbjct: 69  -YSQGKLVRCTQGAVWDVGVDLRKGSPTYGEWAGVELSAENKTMFYIPEGFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSPF 179
                YK T+ Y+ E+D G+ W D  I + WP+  L+ +L   SEKDQ  PFL  I    
Sbjct: 128 EATFNYKCTNLYAPEYDGGIRWNDPEIGVEWPVEGLELLL---SEKDQKQPFLKDIKDTL 184

Query: 180 EY 181
           E+
Sbjct: 185 EF 186


>gi|168481242|gb|ACA24737.1| RmlC [Escherichia coli]
          Length = 178

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++S T+G WV + +SA N  Q++IP GFAHGF+TL    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSSTFGKWVGVNLSAENKRQLWIPEGFAHGFITLSNIAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPFLN 173
            IYK T FY+   +  +AW D  ++I W +    LP VS+KD + LPF N
Sbjct: 130 FIYKTTQFYNPSFERVIAWDDPVLNINWNIKQ--LPIVSKKDMKGLPFSN 177


>gi|115503061|gb|ABI98984.1| RmlC [Escherichia coli]
 gi|156539326|gb|ABU80589.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella flexneri]
 gi|156539341|gb|ABU80599.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella flexneri]
 gi|168481278|gb|ACA24770.1| RmlC [Shigella flexneri 6]
 gi|320185804|gb|EFW60558.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella flexneri CDC 796-83]
          Length = 185

 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 112/175 (64%), Gaps = 2/175 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            +YK T++Y  + D G+ W D  + I WP ++     +S KD     L+ +   F
Sbjct: 130 FLYKTTNYYHPDSDRGIVWNDPILSIKWPTIEHNNYILSIKDARAKELHNMKELF 184


>gi|56684535|gb|AAW22498.1| RmlC [Lactobacillus rhamnosus]
          Length = 190

 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+ ++T  F D+RG+F+ TY+ +   E G+++ F QDN S S + G +RG+H+Q  PYAQ
Sbjct: 13  VKFVETDVFGDNRGFFTGTYTREKFVEAGIKNDFNQDNQSLSAEAGVLRGMHYQMAPYAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGHWEGYILSQYNHRQLLVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YKV  +Y+ E D G+A+ D  I I WP+    L  +SEKDQ+ P L   ++ F Y
Sbjct: 133 VYKVEGYYAPEADRGIAFDDPDIGIDWPMSTAHL-IMSEKDQHHPQLKDAENNFIY 187


>gi|88802242|ref|ZP_01117769.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polaribacter irgensii 23-P]
 gi|88781100|gb|EAR12278.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polaribacter irgensii 23-P]
          Length = 184

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 116/179 (64%), Gaps = 2/179 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++   F D RG+F ++++ +  +E      F+QDN S S   G +RGLHFQ+ P
Sbjct: 8   IQDVYIIEPSIFGDERGYFLESFNLEKFEENIYPIKFLQDNESKS-SKGVLRGLHFQKTP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + QAKLVRCI GR+ D+AVD+R+ SPTYG  V++E+S  N  Q+++P GFAHGF  L   
Sbjct: 67  FDQAKLVRCIVGRVMDVAVDLRKGSPTYGKHVAIELSGENKKQLFVPRGFAHGFSVLSET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YKV + Y+ E+D G+ + D+ ++I W L +  +  +SEKD++LPF   +DSPF +
Sbjct: 127 AVFAYKVDNTYAPEYDFGIRYNDEDLNIDWGLAENEV-QLSEKDKDLPFFKNLDSPFNF 184


>gi|10803348|emb|CAC13136.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter xylinus]
          Length = 185

 Score =  160 bits (405), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 109/174 (62%), Gaps = 6/174 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            N+  + +L   +F D RG+FS+T+++  +KE+G+   FVQDNHS S   G +RGLH Q 
Sbjct: 6   FNVAGIILLTPPRFGDERGYFSETFNAARMKEIGIPGPFVQDNHSLSRARGVVRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ Q KLVRC  G I+D+ VDIR  SPT+G WV   +S  NG Q++IPTGF HGF TL 
Sbjct: 66  SPHPQGKLVRCTRGSIWDVGVDIRAGSPTFGQWVGATLSEENGSQLWIPTGFLHGFCTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQN-LPF 171
            N EV YK TD++  + +  V W D  + I WP+   D IL   S KD + LPF
Sbjct: 126 ENAEVQYKCTDYWDRDCERSVRWDDPLLAIDWPVTPKDAIL---SAKDADALPF 176


>gi|82777434|ref|YP_403783.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella dysenteriae Sd197]
 gi|81241582|gb|ABB62292.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella dysenteriae Sd197]
          Length = 185

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G W+ + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWIGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y+   +  +++ D +I I WP L  +   +S KD N
Sbjct: 130 FVYKTTNYYNPSFEKSISYSDPTIKIQWPNLQDMHFKLSNKDLN 173


>gi|329848964|ref|ZP_08263992.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Asticcacaulis biprosthecum
           C19]
 gi|328844027|gb|EGF93596.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Asticcacaulis biprosthecum
           C19]
          Length = 181

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 115/178 (64%), Gaps = 3/178 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
            +I    +++ +   D RG+F + +     +E  ++DV FVQDN S S   GTIRGLH+Q
Sbjct: 6   FDIEGPALIRPKMIGDERGFFMEAFKDAWFRE-NVEDVSFVQDNQSLSRQVGTIRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
             P+ Q KLVRC+ G IFD+AVDIRR S T+G WV   ++A  G Q+++P GFAH F TL
Sbjct: 65  TAPFGQGKLVRCLKGSIFDVAVDIRRGSATFGKWVGATLTAEKGEQLWVPDGFAHAFCTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           E +TEV YKVT+ YS  +D+G+A+ D  I I WP +D  +  +S+KD+  P L+ + S
Sbjct: 125 EPDTEVFYKVTNPYSKPNDAGLAFDDPDIGIIWP-IDIAMAVLSDKDRLQPPLSSLIS 181


>gi|149277136|ref|ZP_01883278.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter sp. BAL39]
 gi|149232013|gb|EDM37390.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter sp. BAL39]
          Length = 184

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 120/181 (66%), Gaps = 8/181 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + ++D+RG+F +++++K+L + G+   FVQDN SFS   G +RGLH Q+ P
Sbjct: 8   IKGLLIVEPKVWKDNRGYFYESFNAKILSDAGIDVTFVQDNQSFS-QKGALRGLHAQKDP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR I GR+ D+AVDIR++SPT+G   +LE+S  N LQ+++P GF HGF+TLE +
Sbjct: 67  FAQGKLVRVIQGRVMDVAVDIRKSSPTFGQHFALELSGENHLQLWVPPGFLHGFITLEDD 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW----PLLDTILPSVSEKDQNLPFLNQIDSP 178
           T   YKV+++Y    + GV W D  ++I W    P  + +L   S+KDQ LP      SP
Sbjct: 127 TIFTYKVSNYYDKNSEIGVIWNDADLNIEWGKEVPESEFLL---SDKDQVLPAFKDFSSP 183

Query: 179 F 179
           F
Sbjct: 184 F 184


>gi|145298431|ref|YP_001141272.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851203|gb|ABO89524.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 183

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 110/170 (64%), Gaps = 4/170 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + + F D RG+F ++++ +  +E +G Q  F+QDNHS S   G +RGLH+Q 
Sbjct: 7   SIPEVLIFEPQVFGDERGFFFESFNYQQFEEAVGHQVKFIQDNHSRS-SQGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVRCI G +FD+AVDIR  SP +G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 66  PPHAQGKLVRCIVGEVFDVAVDIRETSPNFGQWVGVNLSAENKRQLWIPEGFAHGFLTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
              E++YK T++Y   H+  + W D  + I WP    I+  +S+KD   P
Sbjct: 126 TAAEILYKTTNYYQPSHERSIIWNDNVLAIKWPFDKNII--LSKKDSLAP 173


>gi|258517198|ref|YP_003193420.1| dTDP-4-dehydrorhamnose reductase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257780903|gb|ACV64797.1| dTDP-4-dehydrorhamnose reductase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 461

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 107/178 (60%), Gaps = 3/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N   + +++T    D+RGWF++TY+       G+   FVQDN S+S   GT+RG+HFQ  
Sbjct: 7   NFKGLFVIETNVHGDNRGWFTETYTKSKFAAQGIDTDFVQDNQSYSAQKGTLRGIHFQTN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ K++RC  G I D  VD+R+ S TY  W S+E+SA N  Q+YIP GF H F+T+  
Sbjct: 67  PMAQTKMIRCTRGAIIDTVVDLRKGSDTYKQWYSIELSAENKKQMYIPKGFGHAFLTITE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           + EV YKV ++YS E D  + + D  I I W + +   P +S+KD N P L   D+ F
Sbjct: 127 DVEVQYKVDEYYSKECDRSIKFNDPEIGIDWGIEN---PVLSQKDLNAPLLKDSDADF 181


>gi|297569754|ref|YP_003691098.1| Sigma 54 interacting domain protein [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925669|gb|ADH86479.1| Sigma 54 interacting domain protein [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 181

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 112/169 (66%), Gaps = 4/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +L+ + F D RG+F ++++ ++ ++  G+   FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPEVMLLEPKVFGDERGFFYESFNRRVFEQATGVSGEFVQDNHSRS-RRGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP AQ KLVR + G +FD+AVD+RR SPT G WV + +SA N  Q++IP GFAHGF+TL
Sbjct: 65  LPPKAQGKLVRVVQGEVFDVAVDLRRASPTCGQWVGVHLSAANKHQLWIPPGFAHGFVTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TD+Y+ E++  + W D  + I+WPL D   P ++ KDQ 
Sbjct: 125 SETAEFLYKTTDYYAPEYERCIIWNDPDLAISWPLPDP--PQLAAKDQQ 171


>gi|309787874|ref|ZP_07682484.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella dysenteriae 1617]
 gi|50982494|gb|AAT91848.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella dysenteriae]
 gi|308924273|gb|EFP69770.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shigella dysenteriae 1617]
          Length = 185

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-TKGVLRGLHYQLEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G +FD+AVDIR++SPT+G W+ + +SA N  Q++IP GFAHGF+ L    E
Sbjct: 70  QGKLVRCVVGEVFDVAVDIRKSSPTFGKWIGVNLSAENKRQLWIPEGFAHGFLVLSETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK T++Y+   +  +++ D +I I WP L  +   +S KD N
Sbjct: 130 FVYKTTNYYNPSFEKSISYSDPTIKIQWPNLQDMHFKLSNKDLN 173


>gi|298375207|ref|ZP_06985164.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_19]
 gi|301310780|ref|ZP_07216719.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
 gi|298267707|gb|EFI09363.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_19]
 gi|300832354|gb|EFK62985.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
          Length = 193

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 118/181 (65%), Gaps = 4/181 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ + F+D+RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   DIEGVVIIEPKVFDDARGYFFESFSQREFEEKVRKINFVQDNESMS-SYGVMRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E+S  N  Q ++P GFAHGF  L  
Sbjct: 66  PFTQSKLVRCVKGCVLDVAVDIRKGSPTYGKHVAVELSEENHRQFFVPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  +FY+ + D G+  +D+S+ I W + +D +L  +SEKD   P L   DSPF+
Sbjct: 126 IAVFQYKCDNFYAPQADGGIRIKDESLGIDWRIPMDKVL--LSEKDIKHPCLEDFDSPFD 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|227550496|ref|ZP_03980545.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX1330]
 gi|257888523|ref|ZP_05668176.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,141,733]
 gi|257897102|ref|ZP_05676755.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium Com12]
 gi|257899041|ref|ZP_05678694.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium Com15]
 gi|293377325|ref|ZP_06623529.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium PC4.1]
 gi|293572519|ref|ZP_06683498.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E980]
 gi|227180397|gb|EEI61369.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium TX1330]
 gi|257824577|gb|EEV51509.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium
           1,141,733]
 gi|257833667|gb|EEV60088.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium Com12]
 gi|257836953|gb|EEV62027.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium Com15]
 gi|291607436|gb|EFF36779.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium E980]
 gi|292644017|gb|EFF62123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecium PC4.1]
          Length = 190

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (60%), Gaps = 3/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+ 
Sbjct: 7   KLTDVKIVEMDVFGDHRGFFTESYSKAKFAEHGLDYDFVQDNHSLSAEAGVLRGLHFQKG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P G+AHGF+TL  
Sbjct: 67  EAAQTKLIRVVTGAVLDVVVDIRKGSPTYGQWDGFILSEHNHRQLLVPKGYAHGFVTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS--PF 179
           N   +YK  ++Y+ E D G+A+ D  + I WP +D     +SEKD   P L + ++  PF
Sbjct: 127 NVNFLYKCDNYYNAEADGGIAFDDPDLAIDWP-IDPSRAIMSEKDHRHPTLKEFEAENPF 185

Query: 180 EY 181
            Y
Sbjct: 186 VY 187


>gi|294672873|ref|YP_003573489.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella ruminicola 23]
 gi|294473377|gb|ADE82766.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella ruminicola 23]
          Length = 184

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 115/182 (63%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I+ V I++ R FEDSRG+F +++S +  +E      FVQDN S S   G +RGLHFQRP
Sbjct: 7   SIDGVFIIEPRIFEDSRGYFFESFSQREFEEKIGPINFVQDNESKS-SYGVMRGLHFQRP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELTEDNHRQFFIPKGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY  E D G++  D+S++I W  P    IL   S+KD   P L   ++PF
Sbjct: 126 TAVFQYKCDEFYHPEADGGISILDESLNIDWHIPTDKAIL---SDKDTKHPLLKDFETPF 182

Query: 180 EY 181
            Y
Sbjct: 183 NY 184


>gi|168481330|gb|ACA24817.1| RmlC [Escherichia coli]
          Length = 182

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 112/174 (64%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E +YK T++Y  E D G+ W D  I I W     +   +S+KD+  P +  +
Sbjct: 127 TAEFVYKTTNYYHPESDRGIRWDDPYIGIKWENEYNV--KLSDKDKKNPTMKDV 178


>gi|184154573|ref|YP_001842913.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus fermentum IFO
           3956]
 gi|183225917|dbj|BAG26433.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus fermentum IFO
           3956]
          Length = 193

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 112/182 (61%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+++    F D RG+F++TYS +  KE G+   FVQDN S S   G +RGLHFQR  
Sbjct: 11  LQDVKLITPAVFGDHRGFFTETYSDRDFKEAGINFDFVQDNQSLSAQAGVLRGLHFQRGR 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R+ SPTY  W    +SA+N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDLRKGSPTYKQWEGYILSASNHRQLLVPRGFAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSPF 179
              +YK  ++Y  E D G++++   +DI WP+ LD  +   SEKD N P L +   D+PF
Sbjct: 131 VNFVYKCDNYYDAEADGGISFKTPELDIDWPIDLDKAI--TSEKDANQPTLTEFEKDNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|259503868|ref|ZP_05746770.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus antri DSM
           16041]
 gi|259168169|gb|EEW52664.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus antri DSM
           16041]
          Length = 191

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 110/177 (62%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
            +I++T  F D RG+F++TY+    +  G+   F QDN S S + G +RG+H+Q  PY+Q
Sbjct: 13  AKIVETDVFGDHRGFFTETYTKNKFEAAGINVEFTQDNQSLSVEPGVLRGMHYQLAPYSQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G I+D+ VDIR+ SP YG W    +S  N  Q+ +P GFAHGF+TL  N  V
Sbjct: 73  TKLLRAVTGAIYDVIVDIRKGSPAYGKWEGFILSEYNHRQLLVPKGFAHGFVTLTPNVNV 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV  +Y+ E D G+A+ D  +DI WP+ +D ++  +SEKDQ+ P     +  F Y
Sbjct: 133 AYKVDGYYAPEADRGIAFDDPDLDIKWPMPVDHLI--LSEKDQHHPAFKDAEINFTY 187


>gi|289577889|ref|YP_003476516.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter italicus
           Ab9]
 gi|289527602|gb|ADD01954.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter italicus
           Ab9]
          Length = 183

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 108/173 (62%), Gaps = 2/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++T  FED+RG+F ++Y+ K  K  G+  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGLYIIETGVFEDNRGYFMESYNYKDFKAAGIDAVFVQDNQSKS-KKGVLRGLHFQKK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR + G +FD+AVD+R+NS TYG WV + +S  N  Q YIP GFAHGF+ L   
Sbjct: 69  HPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSDKNKRQFYIPEGFAHGFLVLSDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            E  YK TDFY  + + G+ W D  I+I WPL       +SEKD+  P L  +
Sbjct: 129 AEFFYKCTDFYYPDDEGGIIWNDPDINIQWPLEGIEEVILSEKDKKWPRLRDL 181


>gi|188588490|ref|YP_001922380.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188498771|gb|ACD51907.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 179

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V I++ + F D RGWF +TYS     E+     FVQDN S+S + G +RG+HFQ  
Sbjct: 7   KLDGVYIVEPQVFGDERGWFMETYSKIKTPEIACD--FVQDNQSYSKEKGILRGIHFQNG 64

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQAKLVRC++G + D+AVD+R+ S TY  WV++E+SA N  Q++IP GF HGF+TL  
Sbjct: 65  EHAQAKLVRCVSGAVLDVAVDLRKKSLTYKQWVAVELSAENKKQLFIPRGFGHGFVTLTK 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           + E +YK  ++Y+ E D  + + D  I + W + + IL   SEKD+  P L   D  F
Sbjct: 125 DVEFVYKTDNYYNYESDRSIRFDDPEIGVEWGIENPIL---SEKDKKAPLLQDSDCTF 179


>gi|256963468|ref|ZP_05567639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           HIP11704]
 gi|307272375|ref|ZP_07553631.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0855]
 gi|256953964|gb|EEU70596.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           HIP11704]
 gi|306510929|gb|EFM79943.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0855]
          Length = 190

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIRR SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRRGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|168481319|gb|ACA24807.1| RmlC [Shigella dysenteriae]
          Length = 182

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 112/174 (64%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E +YK T++Y  E D G+ W D  I I W     +   +S+KD+  P +  +
Sbjct: 127 TAEFVYKTTNYYHPESDRGIRWDDPYIGIKWENEYNV--RLSDKDKKNPTMKDV 178


>gi|227887091|ref|ZP_04004896.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli 83972]
 gi|227835441|gb|EEJ45907.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli 83972]
 gi|297499073|gb|ADI43259.1| RmlC [Escherichia coli]
 gi|307554110|gb|ADN46885.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli ABU 83972]
          Length = 180

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 111/167 (66%), Gaps = 4/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+   F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLILEPEVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSIK-GVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++S T+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSGTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             EV+YK   +Y+  H+  + W D  ++I WP   T L ++S+KD N
Sbjct: 127 LAEVLYKTNQYYAPSHERNIIWNDPLLNIKWP--RTALITLSDKDAN 171


>gi|291559812|emb|CBL38612.1| dTDP-4-dehydrorhamnose 3,5-epimerase [butyrate-producing bacterium
           SSC/2]
          Length = 184

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 106/167 (63%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+   +KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIEGLYVIEPTVFKDERGYFVETYNQNDMKEAGLDMVFVQDNQSMS-TRGVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G++FD+AVD+R +S TYG W  +E+SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -FPQGKLVRVVRGKVFDVAVDLRSDSKTYGKWFGVELSAENMKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  I + WPL + +   +SEKDQ 
Sbjct: 128 EAEFCYKCTDFYHPGDEGGLTWNDPEIGVEWPLEEGVDLIISEKDQK 174


>gi|258543636|ref|YP_003189069.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634714|dbj|BAI00690.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637770|dbj|BAI03739.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640824|dbj|BAI06786.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643879|dbj|BAI09834.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646934|dbj|BAI12882.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649987|dbj|BAI15928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652977|dbj|BAI18911.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256656031|dbj|BAI21958.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 190

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 110/185 (59%), Gaps = 5/185 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++   +F D+RG+FS+TY+ + ++E G+ + FVQDN S S   G IRGLH Q 
Sbjct: 6   LAIPDVILITPPRFGDNRGFFSETYNIERMREAGITEPFVQDNQSLSRQKGVIRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC  G I+D+AVD R  SPTYG WV+ E+S  N  Q++IP GF HGF TL 
Sbjct: 66  DPFAQGKLVRCTRGAIWDVAVDARTGSPTYGKWVAAELSEENWSQLWIPPGFLHGFCTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSP 178
            N EV YK T  YS   +  V W    + I WP+   D +L   SEKD   P  +     
Sbjct: 126 ENAEVQYKCTALYSKASERAVIWNSAELGIDWPVKAEDAVL---SEKDLLAPEFSAAKGW 182

Query: 179 FEYDG 183
           F+Y G
Sbjct: 183 FQYVG 187


>gi|328957829|ref|YP_004375215.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Carnobacterium sp. 17-4]
 gi|328674153|gb|AEB30199.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Carnobacterium sp. 17-4]
          Length = 216

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 120/193 (62%), Gaps = 3/193 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V+I++   F D RG+F+++Y+ +   E G+   F+QDNHS S + G +RG+HFQ  
Sbjct: 7   NLQDVKIIEMAVFGDHRGFFTESYTKEKFLEAGIIIDFIQDNHSLSVEPGVLRGMHFQTL 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVR   G I+D+ VD+R  SPTYG W    +S  N  Q+ +P GFAH F+TL  
Sbjct: 67  EKAQTKLVRATTGVIYDVIVDMRVGSPTYGQWEGYILSEFNHRQLLVPKGFAHAFVTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
           N  V YKV +++S EHD G+A+ D +++I WP+ +D ++  +SEKD   P L + ++PF 
Sbjct: 127 NCNVQYKVDEYFSSEHDGGIAFDDPALNIQWPMPIDKLV--LSEKDTKHPKLAEFNNPFV 184

Query: 181 YDGLPLLSLNMER 193
           Y    L  +  E+
Sbjct: 185 YKKFKLGDICNEK 197


>gi|167765914|ref|ZP_02437967.1| hypothetical protein CLOSS21_00405 [Clostridium sp. SS2/1]
 gi|167712412|gb|EDS22991.1| hypothetical protein CLOSS21_00405 [Clostridium sp. SS2/1]
          Length = 194

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 106/167 (63%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+   +KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 20  DIEGLYVIEPTVFKDERGYFVETYNQNDMKEAGLDMVFVQDNQSMS-TRGVLRGLHFQKQ 78

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G++FD+AVD+R +S TYG W  +E+SA N  Q YIP GFAHGF+ L  
Sbjct: 79  -FPQGKLVRVVRGKVFDVAVDLRSDSKTYGKWFGVELSAENMKQFYIPEGFAHGFLVLSD 137

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  I + WPL + +   +SEKDQ 
Sbjct: 138 EAEFCYKCTDFYHPGDEGGLTWNDPEIGVEWPLEEGVDLIISEKDQK 184


>gi|183597260|ref|ZP_02958753.1| hypothetical protein PROSTU_00504 [Providencia stuartii ATCC 25827]
 gi|188023575|gb|EDU61615.1| hypothetical protein PROSTU_00504 [Providencia stuartii ATCC 25827]
          Length = 179

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 107/162 (66%), Gaps = 4/162 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I++ + FED RG+F ++++ K   E +G    FVQDNHS S   G +RGLH+Q  PYA
Sbjct: 11  VLIIEPKIFEDERGFFFESFNQKQFDEAVGYPVNFVQDNHSKSVK-GVLRGLHYQEEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCI G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  N E
Sbjct: 70  QGKLVRCIVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSENAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            +YK T FY+ + ++ + W D  + I W       P +S+KD
Sbjct: 130 FVYKTTKFYNPKSENTILWNDNKLSINWN--SESHPIISKKD 169


>gi|251780228|ref|ZP_04823148.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243084543|gb|EES50433.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 179

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            ++ V I++ + F D RGWF +TYS     E+     FVQDN S+S + G +RG+HFQ  
Sbjct: 7   KLDGVYIVEPQVFGDERGWFMETYSKIKTPEIACD--FVQDNQSYSKEKGILRGIHFQNG 64

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQAKLVRC++G + D+AVD+R+ S TY  WV++E+SA N  Q++IP GF HGF+TL  
Sbjct: 65  EHAQAKLVRCVSGAVLDVAVDLRKKSLTYKQWVAVELSAENKKQLFIPRGFGHGFVTLTN 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           + E +YK  ++Y+ E D  + + D  I + W + + IL   SEKD+  P L   D  F
Sbjct: 125 DVEFVYKTDNYYNYESDRSIRFDDPEIGVEWGIENPIL---SEKDKKAPLLQDSDCTF 179


>gi|63033905|gb|AAY28256.1| RmlC [Escherichia coli]
          Length = 188

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 107/155 (69%), Gaps = 4/155 (2%)

Query: 14  FEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           +ED RG+F ++Y+  K ++ +G    FVQDNHS S   G +RGLHFQ+ PY QAKLVRCI
Sbjct: 19  YEDERGFFYESYNEKKFMETIGASIKFVQDNHSKS-SKGVLRGLHFQKNPYEQAKLVRCI 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G ++D+AVDIR++SPT+G W  + +S  N  Q++IP GFAHGF+TL    E +YK T++
Sbjct: 78  RGEVYDVAVDIRKDSPTFGQWFGVNLSDENKKQLWIPEGFAHGFITLSDVAEFVYKTTNY 137

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           Y+   +  + W DK ++I WPL + ++  VS KDQ
Sbjct: 138 YAPASEYCLKWDDKDLNIQWPLKNALI--VSSKDQ 170


>gi|58039513|ref|YP_191477.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconobacter oxydans 621H]
 gi|58001927|gb|AAW60821.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconobacter oxydans 621H]
          Length = 187

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 111/184 (60%), Gaps = 5/184 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++   +F D+RG+FS+TY+ + + E G+   FVQDN S S   G +RGLH Q 
Sbjct: 6   LSIPEVILVTPPRFGDNRGFFSETYNVERMGEAGIDLPFVQDNQSLSRQKGVVRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PY Q KLVR   G I+D+AVD R  SPTYG WV+ E+SA N  Q++IP GF HGF+TLE
Sbjct: 66  APYEQGKLVRVTRGAIWDVAVDARTGSPTYGKWVAAELSAENWSQLWIPPGFLHGFVTLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSP 178
            NTEV YK T  YS   +  V W    + I WP+   D IL   S+KD+  P   +    
Sbjct: 126 ENTEVQYKCTSLYSKVSERAVIWNCPELKIDWPVSEADAIL---SDKDKVAPHFAEAKGW 182

Query: 179 FEYD 182
           F Y+
Sbjct: 183 FSYE 186


>gi|332686303|ref|YP_004456077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Melissococcus plutonius ATCC
           35311]
 gi|332370312|dbj|BAK21268.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Melissococcus plutonius ATCC
           35311]
          Length = 190

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 108/174 (62%), Gaps = 1/174 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   F DSRG+F+++YS +  +  GL   FVQDNHS S + G +RGLHFQ+  
Sbjct: 8   LQDVKIIEMDVFGDSRGFFTESYSRQKFETFGLNFDFVQDNHSLSSEAGVLRGLHFQKGK 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR I G + D+ VDIR+NSPTYG W S  +S  N  Q+ +P G+AHGF+TL  N
Sbjct: 68  AAQTKLVRVITGALLDVIVDIRKNSPTYGKWESYILSEYNHRQLLVPKGYAHGFVTLTPN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               YK  ++Y+ E D G+A+ D  + I WP +D      SEKD+  P   + +
Sbjct: 128 VNFAYKCDNYYNDEADGGIAFDDPDLGIAWP-MDLNKAITSEKDKKHPTFKEFE 180


>gi|254478574|ref|ZP_05091948.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035503|gb|EEB76203.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Carboxydibrachium pacificum
           DSM 12653]
          Length = 185

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 109/175 (62%), Gaps = 2/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++T  FED+RG+F ++Y+ +  K  G+  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGLYIIETGIFEDNRGYFMESYNYRDFKAAGIDAVFVQDNQSKS-KKGVLRGLHFQKK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR + G +FD+AVD+R+NS TYG WV + +S  N  Q YIP GFAHGF+ L   
Sbjct: 69  HPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSDKNKRQFYIPEGFAHGFLVLSDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            E  YK TDFY  + + G+ W D  I+I WPL       +SEKD+  P L  ++ 
Sbjct: 129 AEFFYKCTDFYYPDDEGGIIWNDPDINIQWPLEGIEEVILSEKDKKWPRLRDLEE 183


>gi|124021807|ref|YP_001016114.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962093|gb|ABM76849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           MIT 9303]
          Length = 201

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 119/186 (63%), Gaps = 10/186 (5%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL---GLQDV--FVQDNHSFSFDCGTIRG 55
           +++N   +L  +   D RG+F ++++ +  +E+     Q+   FVQDNHS S  CG +RG
Sbjct: 12  IHLNGPLLLSPQVHGDERGFFFESWNQRRWQEVLASHRQEAPEFVQDNHSRS-SCGVLRG 70

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LH+Q PP+ Q KLVRC+ G IFD+A+D+RR+S TYG W    +SA N  Q++IP GFAHG
Sbjct: 71  LHYQLPPHPQGKLVRCVVGEIFDVAIDLRRSSATYGQWAGAHLSAENHQQLWIPVGFAHG 130

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL----DTILPSVSEKDQNLPF 171
           F+TL  + EV+YK TDF+S + +  + W D  + I+WP++    D I  S+S+KD     
Sbjct: 131 FLTLSESAEVLYKATDFWSRDCERAIRWDDPRLGISWPVVHVDGDQIPASLSQKDAVASL 190

Query: 172 LNQIDS 177
           + ++ +
Sbjct: 191 MEELSA 196


>gi|254303462|ref|ZP_04970820.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148323654|gb|EDK88904.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 191

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 116/174 (66%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + FEDSRG F ++Y+    K++G+ ++FVQDNHS S   G +RGLHFQ+  
Sbjct: 9   IENLFIIEPQIFEDSRGCFFESYNYNTFKKIGIDNIFVQDNHSKSLK-GVLRGLHFQKED 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+QAKL+  + G I DI VD+R+NS T+G + ++EI+ NN   ++IP GFAHGF+TLE  
Sbjct: 68  YSQAKLISVLKGGILDIVVDLRKNSKTFGKYFAMEINENNKKMLFIPKGFAHGFLTLEDG 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL----LDTILPSVSEKD-QNLPF 171
           TE+ YK  +FY+ + + G+ W D+ ++I W      +D     +SEKD +N+ F
Sbjct: 128 TEIFYKCDNFYNPQSEGGIIWNDRDLNIDWNFKKYNIDKNELIISEKDKKNISF 181


>gi|150019564|ref|YP_001311818.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149906029|gb|ABR36862.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 183

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (61%), Gaps = 5/177 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D RGWF +TYS     E+     F QDN S+S   G +RG+HFQ    AQ
Sbjct: 11  VYIVEPQVFGDERGWFMETYSRIKTPEIACD--FCQDNQSYSKGKGILRGIHFQNGENAQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC+ G + D+AVD+R+ SPTY  WV++E+SA N  Q++IP GF HGF+TL  + E 
Sbjct: 69  AKLVRCVKGAVLDVAVDLRKGSPTYKEWVAVELSAENKKQLFIPRGFGHGFLTLTDDVEF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           +YK  ++Y+ E D  + + D  I + W + + IL   SEKD+  P L   D  F Y+
Sbjct: 129 VYKTDNYYNYESDRSIKFDDPEIGVEWGIENPIL---SEKDKKAPLLKDSDCTFIYN 182


>gi|307265775|ref|ZP_07547326.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919170|gb|EFN49393.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 185

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 109/176 (61%), Gaps = 2/176 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++T  FED+RG+F ++Y+ +  K  G+  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  EIEGLYIIETGIFEDNRGYFMESYNCRDFKAAGIDAVFVQDNQSKS-KKGVLRGLHFQKK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R+NS TYG WV + +S  N  Q YIP GFAHGF+ L  
Sbjct: 69  -HPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSDKNKRQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             E  YK TDFY  + + G+ W D  I+I WPL       +SEKD+  P L  ++ 
Sbjct: 128 EAEFFYKCTDFYYPDDEGGIIWNDPDINIQWPLEGIEEIILSEKDKKWPRLRDLEE 183


>gi|209693793|ref|YP_002261721.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aliivibrio salmonicida
           LFI1238]
 gi|209693856|ref|YP_002261784.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aliivibrio salmonicida
           LFI1238]
 gi|208007744|emb|CAQ77862.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aliivibrio salmonicida
           LFI1238]
 gi|208007807|emb|CAQ77931.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aliivibrio salmonicida
           LFI1238]
          Length = 185

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 112/176 (63%), Gaps = 6/176 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           NI  V+I +   F D RG+F +T+S K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   NIPDVKIFEPTVFGDERGFFMETWSQKKFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+ VDIR NSPT+G WV   +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVVVDIRENSPTFGQWVGTYLSAENKHQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             + E +YK TD+Y+ + +  +AW DK+I I WP+  T  P +SEKD+N   L+Q+
Sbjct: 125 SEDAEFVYKCTDYYNPKSEISIAWDDKAIGIEWPI--TTPPQLSEKDKNAMILSQV 178


>gi|262374524|ref|ZP_06067798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acinetobacter junii SH205]
 gi|262310520|gb|EEY91610.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acinetobacter junii SH205]
          Length = 191

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 112/173 (64%), Gaps = 6/173 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQ---DV--FVQDNHSFSFDCGTIRGLH 57
           I  + IL+ + F D RGWF ++++ K  +   L+   D+  FVQDNHSFS   G +RGLH
Sbjct: 8   IKGLLILEPKVFGDDRGWFMESFNQKSFESALLERGMDIPQFVQDNHSFS-QKGVLRGLH 66

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           +Q  P AQ KLVR + GR +D+AVDIR+NSPT+G WV +E++  N  Q +IP GFAHGF+
Sbjct: 67  YQLNPCAQGKLVRVVQGRAWDVAVDIRQNSPTFGEWVGIELTGENHRQFWIPAGFAHGFI 126

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            LE NT+ +YK T++YS E +  + W D    I WP+   +   +++KD+  P
Sbjct: 127 ALEDNTQFLYKTTNYYSKECERSIVWNDVDFAIEWPIESGLELKLTDKDKLAP 179


>gi|312877140|ref|ZP_07737111.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796114|gb|EFR12472.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 193

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 111/174 (63%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++   FED+RG+F ++++ K   E+GL   FVQDNHS S   G +RGLHFQ P 
Sbjct: 11  IKDLYIIEPTVFEDNRGFFMESWNEKEFNEIGLNIKFVQDNHSRS-KKGVLRGLHFQEP- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR I G +FD+AVDIR +SPT+  W  + +  +N   +YIP GF HGF+TL   
Sbjct: 69  YPQGKLVRVIRGAVFDVAVDIREDSPTFKKWFGIVLDEHNRRMLYIPEGFLHGFLTLSEW 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL--PSVSEKDQNLPFLNQ 174
            +V+YK T++Y  E+D G+ W D  ++I WPL +  +  P +SEKD  LP   +
Sbjct: 129 ADVLYKATEYYYKEYDRGIIWYDPDLEIKWPLEEYGIDKPILSEKDSQLPTFEE 182


>gi|256961442|ref|ZP_05565613.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis Merz96]
 gi|293382820|ref|ZP_06628741.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis R712]
 gi|293387971|ref|ZP_06632504.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis S613]
 gi|312905903|ref|ZP_07764917.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DAPTO
           512]
 gi|312908949|ref|ZP_07767812.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DAPTO
           516]
 gi|256951938|gb|EEU68570.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis Merz96]
 gi|291079811|gb|EFE17175.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis R712]
 gi|291082627|gb|EFE19590.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis S613]
 gi|310628070|gb|EFQ11353.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DAPTO
           512]
 gi|311290733|gb|EFQ69289.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DAPTO
           516]
          Length = 190

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHHQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|315160175|gb|EFU04192.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0312]
          Length = 190

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|29376701|ref|NP_815855.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis V583]
 gi|227520248|ref|ZP_03950297.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0104]
 gi|227555319|ref|ZP_03985366.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis HH22]
 gi|229545293|ref|ZP_04434018.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1322]
 gi|229549528|ref|ZP_04438253.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis ATCC
           29200]
 gi|255972231|ref|ZP_05422817.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T1]
 gi|255975343|ref|ZP_05425929.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T2]
 gi|256617233|ref|ZP_05474079.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis ATCC
           4200]
 gi|256853643|ref|ZP_05559008.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T8]
 gi|256956580|ref|ZP_05560751.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DS5]
 gi|257079506|ref|ZP_05573867.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis JH1]
 gi|257082114|ref|ZP_05576475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis E1Sol]
 gi|257084729|ref|ZP_05579090.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis Fly1]
 gi|257087325|ref|ZP_05581686.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis D6]
 gi|257090459|ref|ZP_05584820.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis CH188]
 gi|257416506|ref|ZP_05593500.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           AR01/DG]
 gi|257419747|ref|ZP_05596741.1| dTDP-4-dehydrorhamnose-3,5-epimerase [Enterococcus faecalis T11]
 gi|257422093|ref|ZP_05599083.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis X98]
 gi|294779045|ref|ZP_06744458.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis PC1.1]
 gi|300861183|ref|ZP_07107270.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TUSoD
           Ef11]
 gi|307270367|ref|ZP_07551672.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX4248]
 gi|307277277|ref|ZP_07558381.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX2134]
 gi|307281879|ref|ZP_07562094.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0860]
 gi|307286604|ref|ZP_07566696.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0109]
 gi|307292430|ref|ZP_07572286.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0411]
 gi|312901449|ref|ZP_07760724.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0470]
 gi|312903793|ref|ZP_07762966.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0635]
 gi|312953335|ref|ZP_07772177.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0102]
 gi|29344165|gb|AAO81925.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis V583]
 gi|227072327|gb|EEI10290.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0104]
 gi|227175530|gb|EEI56502.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis HH22]
 gi|229305346|gb|EEN71342.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis ATCC
           29200]
 gi|229309643|gb|EEN75630.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1322]
 gi|255963249|gb|EET95725.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T1]
 gi|255968215|gb|EET98837.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T2]
 gi|256596760|gb|EEU15936.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis ATCC
           4200]
 gi|256710586|gb|EEU25629.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T8]
 gi|256947076|gb|EEU63708.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis DS5]
 gi|256987536|gb|EEU74838.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis JH1]
 gi|256990144|gb|EEU77446.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis E1Sol]
 gi|256992759|gb|EEU80061.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis Fly1]
 gi|256995355|gb|EEU82657.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis D6]
 gi|256999271|gb|EEU85791.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis CH188]
 gi|257158334|gb|EEU88294.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           ARO1/DG]
 gi|257161575|gb|EEU91535.1| dTDP-4-dehydrorhamnose-3,5-epimerase [Enterococcus faecalis T11]
 gi|257163917|gb|EEU93877.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis X98]
 gi|294453875|gb|EFG22264.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis PC1.1]
 gi|300850222|gb|EFK77972.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TUSoD
           Ef11]
 gi|306496559|gb|EFM66120.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0411]
 gi|306502315|gb|EFM71596.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0109]
 gi|306503833|gb|EFM73055.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0860]
 gi|306506207|gb|EFM75373.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX2134]
 gi|306513275|gb|EFM81902.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX4248]
 gi|310628723|gb|EFQ12006.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0102]
 gi|310632867|gb|EFQ16150.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0635]
 gi|311291438|gb|EFQ69994.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0470]
 gi|315025875|gb|EFT37807.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX2137]
 gi|315028190|gb|EFT40122.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX4000]
 gi|315033452|gb|EFT45384.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0017]
 gi|315035720|gb|EFT47652.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0027]
 gi|315146138|gb|EFT90154.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX2141]
 gi|315146325|gb|EFT90341.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX4244]
 gi|315149175|gb|EFT93191.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0012]
 gi|315154455|gb|EFT98471.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0031]
 gi|315157127|gb|EFU01144.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0043]
 gi|315161848|gb|EFU05865.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0645]
 gi|315164320|gb|EFU08337.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1302]
 gi|315171507|gb|EFU15524.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1342]
 gi|315173060|gb|EFU17077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1346]
 gi|315575180|gb|EFU87371.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           TX0309B]
 gi|315578166|gb|EFU90357.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX0630]
 gi|315582607|gb|EFU94798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis
           TX0309A]
 gi|327535586|gb|AEA94420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis OG1RF]
          Length = 190

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|3608395|gb|AAC35921.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis OG1RF]
          Length = 190

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|256762995|ref|ZP_05503575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T3]
 gi|256684246|gb|EEU23941.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis T3]
          Length = 190

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKTKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|302388126|ref|YP_003823948.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium saccharolyticum
           WM1]
 gi|302198754|gb|ADL06325.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium saccharolyticum
           WM1]
          Length = 184

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 105/167 (62%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + +++   F DSRG+F +TY+    +E GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  GIKGLFVIEPAVFHDSRGYFMETYNQNDFQEAGLDMVFVQDNQSMSAK-GVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G++FD+AVD+R +S TYG W  +E+SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -FPQGKLVRVVRGKVFDVAVDLRSSSETYGKWFGVELSAENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D SI I WP+ + +   +S+KDQ 
Sbjct: 128 EAEFAYKCTDFYHPGDEGGILWSDPSIGIDWPIEEGMELIISDKDQK 174


>gi|315166501|gb|EFU10518.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1341]
          Length = 190

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ +DIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIIDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|260170808|ref|ZP_05757220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
 gi|315919142|ref|ZP_07915382.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
 gi|313693017|gb|EFS29852.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
          Length = 190

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  V I++ R F+D RG+F +++S +   E      FVQDN S S   G +RGLHFQ  
Sbjct: 7   NIEGVVIIEPRLFKDDRGYFFESFSQREFDEKVRPIKFVQDNESMS-SYGVMRGLHFQTM 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY+Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++  N  Q +IP GFAHGF  L  
Sbjct: 66  PYSQSKLVRCVKGTVLDVAVDIRKGSPTYGQHVAVELTEENHRQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ +HD G++  D S+ I W  P    IL   SEKD   P L   +SPF
Sbjct: 126 KAVFQYKCDNFYAPQHDGGISILDDSLGICWRIPTGKAIL---SEKDTKHPLLKDFESPF 182

Query: 180 EY 181
            Y
Sbjct: 183 LY 184


>gi|189092408|gb|ACD75808.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli]
 gi|288816217|gb|ADC54940.1| RmlC [Escherichia coli]
 gi|315285630|gb|EFU45072.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 110-3]
 gi|323956203|gb|EGB51954.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli H263]
          Length = 185

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 110/169 (65%), Gaps = 3/169 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +L+ + F D RG+F ++Y+  +  K +G    FVQDNHS S   G +RGLH+Q  PYAQA
Sbjct: 13  VLEPKVFSDERGFFMESYNQIEFEKAIGRHVNFVQDNHSKS-SKGVLRGLHYQLAPYAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVRC+ G++FD+AVD+R+NSPT+  W  + +SA N  Q++IP GFAHGF+      E I
Sbjct: 72  KLVRCVVGQVFDVAVDLRKNSPTFKKWFGITLSAENKRQLWIPEGFAHGFLVTSDEAEFI 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           YK T++Y+  H   + + D  ++I WP   + L S+S+KDQ     +++
Sbjct: 132 YKTTNYYAPGHQQAIIYNDPILNIDWPFCSSAL-SLSQKDQEAKLFSEL 179


>gi|300853735|ref|YP_003778719.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium ljungdahlii DSM
           13528]
 gi|300433850|gb|ADK13617.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium ljungdahlii DSM
           13528]
          Length = 185

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 109/174 (62%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V +++T  F D+RG+F +TY+    K  GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 14  IKGVYVIETGIFGDNRGYFMETYNYNEFKASGLDMVFVQDNQSKS-KKGVLRGLHFQKN- 71

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q KLVR + G++FD+AVD+R  S TYG WV + +S  N  Q YIP GFAHGF+ L   
Sbjct: 72  YSQGKLVRVVKGKVFDVAVDLRDGSSTYGKWVGVTLSEENKKQFYIPKGFAHGFLVLSDE 131

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQ 174
            E  YK T+FY  E + G+ W D  I+I WPL  +D I+   SEKD+  P L +
Sbjct: 132 AEFCYKCTEFYHPEDEGGIIWNDTDINIKWPLEGIDNII--FSEKDKLWPTLKE 183


>gi|117620166|ref|YP_857409.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561573|gb|ABK38521.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 187

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 4/162 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           + + + R F D RG+F ++++ KL ++ +G    FVQDNHS S   G +RGLH+Q PP+A
Sbjct: 11  ILLFEPRVFSDERGFFFESFNHKLFEDAVGYPVTFVQDNHSKS-SKGVLRGLHYQLPPHA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCI G IFD+AVDIR++SPT+G WV   +S  N  Q++IP GFAHGF+T     E
Sbjct: 70  QGKLVRCIIGEIFDVAVDIRKSSPTFGRWVGAHLSDTNKRQLWIPEGFAHGFITRTETAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           V+YK T++Y  + ++ + W D+ + I W   + +LP +S KD
Sbjct: 130 VLYKATNYYQPDFENSICWNDQQLSIKWD--NDMLPVLSRKD 169


>gi|300768302|ref|ZP_07078206.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|300494090|gb|EFK29254.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
          Length = 193

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 109/181 (60%), Gaps = 3/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   F D RG+F++TYS +  KE G+   F+QDN S S + G +RGLHFQR  
Sbjct: 11  LQDVKIIEPAVFGDKRGFFTETYSDRDFKEAGIDFDFIQDNQSLSAEAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R  SPTYG W    IS +N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDVRAGSPTYGEWEGYIISESNHRQLLVPRGFAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID--SPFE 180
              +YK  ++Y+ E D G+ + DK ++I WP +D      SEKD       + +  +PF 
Sbjct: 131 VNFLYKCDNYYNAEADGGITFMDKDLNINWP-IDYDQAITSEKDAKQQTFKEFEQNNPFA 189

Query: 181 Y 181
           Y
Sbjct: 190 Y 190


>gi|283798719|ref|ZP_06347872.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. M62/1]
 gi|291073581|gb|EFE10945.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. M62/1]
 gi|295090733|emb|CBK76840.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium cf.
           saccharolyticum K10]
 gi|295114995|emb|CBL35842.1| dTDP-4-dehydrorhamnose 3,5-epimerase [butyrate-producing bacterium
           SM4/1]
          Length = 184

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 104/167 (62%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+    KE GL  VFVQDN S S   G +RGLH+Q+ 
Sbjct: 10  DIKGLYVIEPTVFKDERGYFVETYNQNDFKEAGLDMVFVQDNQSMSVK-GVLRGLHYQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I G +FD+AVD+R +S TYG W  + +SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -YPQGKLVRAIRGTVFDVAVDLRADSETYGKWFGVVLSAENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+AW D  I + WP+ + +   +SEKDQ 
Sbjct: 128 EAEFAYKCTDFYHPGDEGGLAWNDPEIGVEWPIEEGMKLIISEKDQK 174


>gi|306814843|ref|ZP_07449005.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli NC101]
 gi|305852237|gb|EFM52689.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli NC101]
 gi|323968167|gb|EGB63576.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli M863]
 gi|327253165|gb|EGE64819.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli STEC_7v]
          Length = 185

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 110/169 (65%), Gaps = 3/169 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +L+ + F D RG+F ++Y+  +  K +G    FVQDNHS S   G +RGLH+Q  PYAQA
Sbjct: 13  VLEPKVFSDERGFFMESYNQIEFEKTIGRHVNFVQDNHSKS-SKGVLRGLHYQLAPYAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVRC+ G++FD+AVD+R+NSPT+  W  + +SA N  Q++IP GFAHGF+      E I
Sbjct: 72  KLVRCVVGQVFDVAVDLRKNSPTFKKWFGITLSAENKRQLWIPEGFAHGFLVTSDEAEFI 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           YK T++Y+  H   + + D  ++I WP   + L S+S+KDQ     +++
Sbjct: 132 YKTTNYYAPGHQQAIIYNDPILNIDWPFCSSAL-SLSQKDQEAKLFSEL 179


>gi|332667357|ref|YP_004450145.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336171|gb|AEE53272.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 183

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 105/159 (66%), Gaps = 3/159 (1%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           F D RG F++T+  +    +G    FVQ NHS +   GT+RG+HFQ+ P+++ KL+RCI 
Sbjct: 19  FTDERGMFARTFCKQEFAAIGHNKEFVQFNHSQNQRQGTLRGMHFQKAPFSEIKLIRCIR 78

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           GR+FD+ VD+R  SPT+  +  +E+S +N   IY+P GFAHGF TLE +TE+IY  T FY
Sbjct: 79  GRVFDVIVDLRAQSPTFLQYYGVELSESNLRMIYVPEGFAHGFQTLEDHTELIYHHTAFY 138

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
           +   + G+ ++D  I I WP   +I   +SEKDQN PF+
Sbjct: 139 TPGQERGIHYKDPRIKIEWPAATSI---ISEKDQNYPFI 174


>gi|255321114|ref|ZP_05362280.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acinetobacter radioresistens
           SK82]
 gi|255301668|gb|EET80919.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acinetobacter radioresistens
           SK82]
          Length = 183

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 110/170 (64%), Gaps = 6/170 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYS----SKLLKELGLQ-DVFVQDNHSFSFDCGTIRGLH 57
           I  + IL    F D RGWF ++++    ++ L++L L    FVQDNHS S     +RGLH
Sbjct: 8   IEGLLILHPNVFGDDRGWFMESFNQQRFAQALEQLNLPVPTFVQDNHSLS-QKSVLRGLH 66

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           +Q  PYAQ KLVR + GR++D+AVDIR +S TYG WV +E+SA N    +IP GFAHGF+
Sbjct: 67  YQNAPYAQGKLVRVVQGRVWDVAVDIRPDSKTYGEWVGVELSAENKTMFWIPEGFAHGFI 126

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            LE NT+ +YK T++Y+ E +  + W D ++ I WPL +     VS+KDQ
Sbjct: 127 ALEDNTQFLYKTTNYYNKESEGTIIWNDPTLAINWPLDEVGEVLVSDKDQ 176


>gi|323481258|gb|ADX80697.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis 62]
          Length = 190

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F+++YS     E G+   FVQDNHS S + G +RGLHFQ+   AQ
Sbjct: 11  VKIIEMDVFGDHRGFFTESYSKAKFAEHGIDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   
Sbjct: 71  TKLIRVVTGAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNF 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFE 180
           +YK  ++Y+   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF 
Sbjct: 131 MYKCDNYYNAAADGGIAFNDPTLAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFI 186

Query: 181 Y 181
           Y
Sbjct: 187 Y 187


>gi|226941907|ref|YP_002796981.1| RfbC [Laribacter hongkongensis HLHK9]
 gi|226716834|gb|ACO75972.1| RfbC [Laribacter hongkongensis HLHK9]
          Length = 182

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 114/165 (69%), Gaps = 4/165 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V+I++ R FED RG+F ++++ +  +E +G    FVQDNHS S   G +RGLH+Q+ 
Sbjct: 8   IAEVKIIEPRVFEDERGFFFESFNQQRFEEAIGYPVEFVQDNHSRS-SRGVLRGLHYQQA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ KLVRC+AG ++D+AVD+R++SPT+G  V +E+SA N  Q++IP GFAHGF+TL  
Sbjct: 67  PHAQGKLVRCVAGAVWDVAVDLRQSSPTFGQSVGVELSAGNRRQLWIPAGFAHGFLTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           + E +YK TD+Y+   +  + W D  + I WP  + + P +S KD
Sbjct: 127 SAEFLYKTTDYYAPAAEVCLRWNDPVLAIAWP--EAVSPVLSVKD 169


>gi|297620313|ref|YP_003708450.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Waddlia chondrophila WSU
           86-1044]
 gi|297375614|gb|ADI37444.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Waddlia chondrophila WSU
           86-1044]
          Length = 175

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 109/165 (66%), Gaps = 3/165 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V ++   K ED RG+F++T+ S+  +E GL+  FVQ N SFS + GT+RG+H+Q PP+A+
Sbjct: 11  VFLINLEKREDERGFFARTFCSEEFREKGLETAFVQANDSFSIEQGTLRGMHYQLPPFAE 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRCI G ++D  +D+R +SPT+G      +SA+N   +Y+P GFAHGF+TLE  TEV
Sbjct: 71  TKLVRCIKGSLYDAVLDLREDSPTFGQSFGTILSADNRTMMYVPRGFAHGFLTLEPYTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            Y V+  YS + + G+ W D   +I+WP    +   +SE+D + P
Sbjct: 131 YYLVSAPYSPKFERGIRWNDPRFNISWPEPPRV---ISERDNSHP 172


>gi|307340809|gb|ADN43869.1| RmlC [Escherichia coli]
          Length = 180

 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 111/166 (66%), Gaps = 3/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I + + F D RG+F ++++ K+ +E     V FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIPDVLIFEPKVFYDERGFFFESFNQKVFEEAVAHKVEFVQDNHSKS-SKGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 66  EPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFITLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP-LLDTILPSVSEK 165
              E +YK T FYS +H+  + + D++I I WP + D  L S  +K
Sbjct: 126 DIAEFLYKTTSFYSPKHEVCIRFNDENIGIHWPNITDNTLISPKDK 171


>gi|253583715|ref|ZP_04860913.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium varium ATCC
           27725]
 gi|251834287|gb|EES62850.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium varium ATCC
           27725]
          Length = 189

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 110/170 (64%), Gaps = 6/170 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + IL+   F D RG+F +TY+ K  +E+G+ + FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IEGLYILEPTVFGDERGFFLETYNKKEFEEIGIFEEFVQDNHSKS-KRGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           ++Q KLVR I G ++D+AVDIR+ SPTYG W  +E+SA N    +IP GFAHGF+TLE  
Sbjct: 69  HSQGKLVRVIRGAVYDVAVDIRKGSPTYGKWYGIELSAKNKKMFFIPKGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQN 168
           TE  YK TD Y  E+DSG+ W DK IDI W      L      +SEKD+N
Sbjct: 129 TEFQYKCTDLYHSEYDSGIMWNDKDIDINWNFEKYGLKEDDVVLSEKDKN 178


>gi|298480819|ref|ZP_06999014.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
 gi|298272842|gb|EFI14408.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
          Length = 190

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 109/182 (59%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  V I++ R F D RG+F +++S +   E      FVQDN S S   G +RGLHFQ  
Sbjct: 7   NIEGVVIIEPRLFMDDRGYFFESFSQREFDEKVHPVKFVQDNESMS-SYGVMRGLHFQTM 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E++  N  Q +IP GFAHGF  L  
Sbjct: 66  PYCQSKLVRCVEGAVLDVAVDIRKGSPTYGQHVAVELTEENHRQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ +HD G++  D+S+ I W  P    IL   SEKD   P L   +SPF
Sbjct: 126 TAVFQYKCDNFYAPQHDGGISILDESLGICWRMPTGKAIL---SEKDTKHPLLKDFESPF 182

Query: 180 EY 181
            Y
Sbjct: 183 LY 184


>gi|219849033|ref|YP_002463466.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus aggregans DSM
           9485]
 gi|219543292|gb|ACL25030.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus aggregans DSM
           9485]
          Length = 176

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 108/168 (64%), Gaps = 3/168 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
             I++    ED+RG+F++ ++     E GL D  VQ N S++   GT+RG+HFQ  PYA+
Sbjct: 11  AHIIELEPREDNRGFFARVWAKDEFAEHGLVDRVVQMNLSYNRLAGTLRGMHFQHAPYAE 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVRCI G I+D+ +D+R +SPTY  W+ + ++A N L +Y+P GFAHGF TLE +TEV
Sbjct: 71  TKLVRCIRGAIYDVIIDLRPDSPTYKRWIGVTLTAANRLALYVPEGFAHGFQTLEDDTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
            Y+V+ +Y+   + GV + D +  I WPL  T    +SEKD+  P  N
Sbjct: 131 FYQVSQYYTPSAEGGVRYDDPAFGIEWPLPVT---EMSEKDKRWPLFN 175


>gi|254556200|ref|YP_003062617.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum JDM1]
 gi|254045127|gb|ACT61920.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum JDM1]
          Length = 193

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 109/181 (60%), Gaps = 3/181 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   F D RG+F++TYS +  KE G+   F+QDN S S + G +RGLHFQR  
Sbjct: 11  LQDVKIIEPAVFGDKRGFFTETYSDRDFKEAGIDFDFIQDNQSLSAEAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R  SPTYG W    IS +N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDVRAGSPTYGEWEGYIISESNHRQLLVPRGFAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID--SPFE 180
              +YK  ++Y+ E D G+ + DK ++I WP +D      SEKD       + +  +PF 
Sbjct: 131 VNFLYKCDNYYNAEADGGITFMDKDLNINWP-IDYDQAITSEKDAKQQTFKEFEQNNPFV 189

Query: 181 Y 181
           Y
Sbjct: 190 Y 190


>gi|126464817|ref|YP_001041793.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides ATCC
           17029]
 gi|221634575|ref|YP_002523263.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides
           KD131]
 gi|126106632|gb|ABN79157.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides ATCC
           17029]
 gi|221163448|gb|ACM04410.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides
           KD131]
          Length = 187

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 107/177 (60%), Gaps = 1/177 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL  R F D+RG F + ++   L+ LG+   FVQDN S S   GT+RGLH+Q PP+AQ
Sbjct: 11  VLILTPRVFGDARGSFCEAWNRATLQGLGIDLDFVQDNQSISAPVGTVRGLHYQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G I D+AVD+R  SPTYG WV +E++A N  Q+ +P GF HGF+T E +T V
Sbjct: 71  DKLVRVGHGAILDVAVDVRVGSPTYGRWVGVELTAGNARQLLVPKGFLHGFVTREPDTVV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           +YK TD Y+ + D  V + D  + I W  +D     +S+KD   P      SPF  +
Sbjct: 131 LYKTTDVYAPDCDGAVHFADPDLGIDWG-IDPASAVLSDKDARAPRFADWTSPFSIE 186


>gi|125654612|ref|YP_001033806.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386272|gb|ABA81701.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein [Rhodobacter
           sphaeroides 2.4.1]
          Length = 187

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 107/177 (60%), Gaps = 1/177 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL  R F D+RG F + ++   L+ LG+   FVQDN S S   GT+RGLH+Q PP+AQ
Sbjct: 11  VLILTPRVFGDARGSFCEAWNRATLQGLGIDLDFVQDNQSISAPVGTVRGLHYQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G I D+AVD+R  SPTYG WV +E++A N  Q+ +P GF HGF+T E +T V
Sbjct: 71  DKLVRVGHGAILDVAVDVRVGSPTYGRWVGVELTAGNARQLLVPKGFLHGFVTREPDTVV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           +YK TD Y+ + D  V + D  + I W  +D     +S+KD   P      SPF  +
Sbjct: 131 LYKTTDVYAPDCDGAVHFADPDLGIDWG-IDPASAVLSDKDARAPRFADWTSPFSIE 186


>gi|171463076|ref|YP_001797189.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192614|gb|ACB43575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 186

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 111/165 (67%), Gaps = 3/165 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I+ V I++ + F D RGWF+++++++   K  GL   FVQDNHSFS    T+RGLH+Q  
Sbjct: 12  IHDVFIVEPKVFGDERGWFTESFNAEDFAKATGLDVRFVQDNHSFSRQW-TLRGLHYQME 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR +AG +FD+AVDIR++SPT+G WV +E+SA N  Q++IP   AHGF+ L  
Sbjct: 71  K-TQGKLVRVVAGSVFDVAVDIRKDSPTFGKWVGVELSAENHKQLWIPAQLAHGFLVLSP 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             E +YK TD+Y  + ++ +AW D ++ I WPL   I P+++ KD
Sbjct: 130 TAEFLYKTTDYYHPQSEACLAWSDPTVGIEWPLPSGIQPNMNAKD 174


>gi|332561399|ref|ZP_08415714.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides WS8N]
 gi|332274198|gb|EGJ19515.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides WS8N]
          Length = 187

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 106/177 (59%), Gaps = 1/177 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL  R F D+RG F + +    L+ LG+   FVQDN S S   GT+RGLH+Q PP+AQ
Sbjct: 11  VLILTPRVFGDARGSFCEAWKRATLQGLGIDLDFVQDNQSISAPVGTVRGLHYQAPPHAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G I D+AVD+R  SPTYG WV +E++A N  Q+ +P GF HGF+T E +T V
Sbjct: 71  DKLVRVGHGAILDVAVDVRVGSPTYGRWVGVELTAGNARQLLVPKGFLHGFVTREPDTVV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           +YK TD Y+ + D  V + D  + I W  +D     +S+KD   P      SPF  +
Sbjct: 131 LYKTTDVYAPDCDGAVHFADPDLGIDWG-IDPASAVLSDKDARAPRFADWTSPFSIE 186


>gi|257867753|ref|ZP_05647406.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           EC30]
 gi|257874080|ref|ZP_05653733.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           EC10]
 gi|257801836|gb|EEV30739.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           EC30]
 gi|257808244|gb|EEV37066.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus casseliflavus
           EC10]
          Length = 190

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 113/182 (62%), Gaps = 3/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V++++   + D RG+F+++YS +     G+   FVQDNHS S + G +RGLHFQ+ 
Sbjct: 7   KLTDVKLIEMDVYGDHRGFFTESYSKEKFSAQGIDFDFVQDNHSLSAEAGVLRGLHFQKG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R + G + D+ VDIR+ SPTYG W    ++ +N  Q+ +P G+AHGFMTL  
Sbjct: 67  EAAQTKLIRVVTGAVLDVIVDIRKGSPTYGEWEGYLLTEHNHRQLLVPRGYAHGFMTLTP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN--QIDSPF 179
           N   +YK  ++Y+ E D G+A+ D  + ITWP +D     +SEKD+  P L   +I++ F
Sbjct: 127 NVNFLYKCDNYYNAEADGGIAFDDPDLAITWP-IDVKKAILSEKDKKHPTLKEFEIENTF 185

Query: 180 EY 181
            Y
Sbjct: 186 IY 187


>gi|254458121|ref|ZP_05071547.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Campylobacterales bacterium
           GD 1]
 gi|207084957|gb|EDZ62243.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Campylobacterales bacterium
           GD 1]
          Length = 187

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 112/177 (63%), Gaps = 3/177 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L  + F D RG+F ++YS     E G+   F+QDNHS+S D  T RGLH+Q  P AQ
Sbjct: 11  VLVLTPKIFNDERGFFYESYSKNSFLEHGVNHDFIQDNHSYSRDKYTFRGLHYQMNPKAQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
             L+R ++G I D AVD+R+NSPTYG + S+ +SA N  Q+ IP GFAHGF+TL  N  +
Sbjct: 71  TTLIRVVSGEIMDFAVDLRKNSPTYGQYTSVLLSAENHKQLLIPKGFAHGFLTLTDNVNI 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YK+ D Y+ E+D  +  +D  +DI   +  D I  ++++KD+  P L  I++ F Y
Sbjct: 131 LYKMDDIYAPEYDRILNVRDHQVDIKLGVDFDKI--TIAKKDEKAPMLENIENNFIY 185


>gi|171057313|ref|YP_001789662.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptothrix cholodnii SP-6]
 gi|170774758|gb|ACB32897.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptothrix cholodnii SP-6]
          Length = 183

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 114/170 (67%), Gaps = 3/170 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I++ + F D+RG+F ++++ S+    +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   DIADVLIIEPKVFGDARGFFMESWNQSRFDAAVGSPVRFVQDNHSRSAR-GVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR   G +FD+AVD+RR+SPT G W+  E+SA+N  +++IP GFAHGFM L 
Sbjct: 66  PPHAQGKLVRVTRGVVFDVAVDLRRSSPTLGRWICTELSADNHRELWIPPGFAHGFMVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            + + +YK TD+++ + ++ V W D  + I WP LDT  P +S KDQ  P
Sbjct: 126 DSADFLYKTTDYHAPDCEAAVRWDDPELAIAWPALDTP-PLLSAKDQQAP 174


>gi|317968490|ref|ZP_07969880.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. CB0205]
          Length = 196

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 109/168 (64%), Gaps = 8/168 (4%)

Query: 8   ILKTRKFEDSRGWFSQTYSSK----LLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPP 62
           ++  R F DSRG+F ++++ +    +L+  G     FVQDNHS S   G +RGLHFQ+ P
Sbjct: 19  LITPRVFGDSRGFFYESWNQRSFNAVLEADGQSSADFVQDNHSRSTQ-GVLRGLHFQKDP 77

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVRCI G IFD+AVD R++SPT+G W+S  +S++N  Q+++P GFAHGF+TL   
Sbjct: 78  HGQGKLVRCIQGEIFDVAVDCRQSSPTFGQWISARLSSDNQQQLWVPVGFAHGFLTLSAQ 137

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            EV+YK TDF+  E +  + W D  + I WP   +  P ++EKD   P
Sbjct: 138 AEVLYKTTDFWDRESERSLLWSDPDLAIAWP--QSTAPLLAEKDAAAP 183


>gi|325281645|ref|YP_004254187.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Odoribacter splanchnicus DSM
           20712]
 gi|324313454|gb|ADY34007.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Odoribacter splanchnicus DSM
           20712]
          Length = 190

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 113/182 (62%), Gaps = 8/182 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQRP 61
           I  V I++ R F D RG+F +++S +  +    + VFVQDN S S  C G +RGLHFQ+P
Sbjct: 8   IPGVVIVQPRIFGDERGYFFESFSQRDFERQVCKTVFVQDNESKS--CYGVVRGLHFQQP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ+KLVR + GR+ D+AVDIR+ SPT+G  VS+E++  N  Q ++P GFAHGF  L  
Sbjct: 66  PYAQSKLVRVVKGRVLDVAVDIRKGSPTFGKHVSVELTEENKRQFFVPRGFAHGFAVLSA 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ E +  +AW D  + I W  P    IL   SEKD+  P L ++D  F
Sbjct: 126 EAVFQYKCDNFYAPESEGALAWDDPDLGIDWRIPAAKMIL---SEKDKRHPRLKEVDWLF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|326391871|ref|ZP_08213383.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325992089|gb|EGD50569.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 183

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 108/174 (62%), Gaps = 2/174 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++T  FED+RG+F ++Y+ +  K  G+  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  EIEGLYIIETGIFEDNRGYFMESYNYRDFKAAGIDAVFVQDNQSKS-KKGVLRGLHFQKK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R++S TYG WV + +S  N  Q YIP GFAHGF+ L  
Sbjct: 69  -HPQGKLVRVLKGEVFDVAVDLRKDSKTYGKWVGVILSDKNKRQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E  YK TDFY  + + G+ W D  I+I WPL       +SEKD+  P L  +
Sbjct: 128 EAEFFYKCTDFYYPDDEGGIIWNDPDINIQWPLDGIEEIILSEKDKKWPRLRDL 181


>gi|325300031|ref|YP_004259948.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides salanitronis DSM
           18170]
 gi|324319584|gb|ADY37475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides salanitronis DSM
           18170]
          Length = 183

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 107/181 (59%), Gaps = 6/181 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++ R F D RG+F +++S +   E      FVQDN S S   G +RGLHFQRP
Sbjct: 7   GIEGVVIIEPRLFRDERGYFFESFSQREFDEKVGHVTFVQDNESMS-SYGVMRGLHFQRP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ QAKLVRC+ G + D+AVDIR+ SPTYG  V++E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFTQAKLVRCVKGAVLDVAVDIRKGSPTYGKHVAVELTEDNHRQFFIPKGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY  E + G++  DK + I W  P    IL   S KD   P L   ++PF
Sbjct: 126 TAVFQYKCDEFYHPEAEGGISILDKELGIDWRIPADGAIL---SGKDTAHPLLKDFETPF 182

Query: 180 E 180
           E
Sbjct: 183 E 183


>gi|332525494|ref|ZP_08401652.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Rubrivivax
           benzoatilyticus JA2]
 gi|332108761|gb|EGJ09985.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Rubrivivax
           benzoatilyticus JA2]
          Length = 191

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (61%), Gaps = 8/175 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSS----KLLKELGLQDV--FVQDNHSFSFDCGTIRGLHFQ 59
           V I++   + D RGWF +T++     + L ELG      FVQDNHS S   G +RGLH+Q
Sbjct: 11  VLIVEPAVYGDERGWFMETFNEPRWRRALDELGEPQPRPFVQDNHSCSH-AGVLRGLHYQ 69

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR + GR FD+AVDIRR S  +G W  +E+ A N  QI+IP GFAHGF+ L
Sbjct: 70  LPPHAQGKLVRVVKGRAFDVAVDIRRGSAHFGQWFGVELDAVNRRQIWIPEGFAHGFLAL 129

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP-LLDTILPSVSEKDQNLPFLN 173
           E +T+V+YK TD Y+   + G+ W D  + I WP L +   P +SE+D     L 
Sbjct: 130 EDDTQVLYKTTDVYAAPCEGGIRWDDPDLAIRWPSLPNGAPPRLSERDARAAALK 184


>gi|323697532|ref|ZP_08109444.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio sp. ND132]
 gi|323457464|gb|EGB13329.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio desulfuricans
           ND132]
          Length = 189

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 111/177 (62%), Gaps = 1/177 (0%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L  + F+D RG+F ++Y++   +ELG+   F+QDNH++S D G +RG HFQRPP AQAK
Sbjct: 13  VLVPQVFQDERGFFLESYNANHFRELGITCTFIQDNHAYSRDVGVLRGFHFQRPPQAQAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV    G + D+ VD+R  SPTYG W  + +SA N  +++IP GF H ++T+  +TE  Y
Sbjct: 73  LVWVTRGAVLDVVVDLRIGSPTYGRWQHVILSAANFKRMFIPRGFGHAYVTIMPDTEFQY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITW-PLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           KV   Y+   + G+AW D  I + W   L    P +SEKD+ L  L   +SPF ++G
Sbjct: 133 KVDAPYAPALEGGLAWDDPDIGMDWDAALHGQEPILSEKDRRLSGLAGFESPFTFEG 189


>gi|56752004|ref|YP_172705.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus elongatus PCC
           6301]
 gi|81300907|ref|YP_401115.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus elongatus PCC
           7942]
 gi|56686963|dbj|BAD80185.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus elongatus PCC
           6301]
 gi|81169788|gb|ABB58128.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus elongatus PCC
           7942]
          Length = 183

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 108/162 (66%), Gaps = 3/162 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++   EL GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VCILEPKVFGDDRGFFLESFNARTFAELTGLNVTFVQDNHSRS-QQGVLRGLHYQ-IQQA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRC+ G IFD+AVD+R++SP +G WV   +SA+N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRCVVGEIFDVAVDLRQSSPQFGQWVGERLSADNHRQLWVPPGFAHGFLVLSESAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           V+YK TD+Y+  H+  + W D +I I WPL     P +S KD
Sbjct: 129 VLYKTTDYYAPTHERSLRWDDPAIAIDWPLAAGQQPQLSAKD 170


>gi|84489349|ref|YP_447581.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosphaera stadtmanae DSM
           3091]
 gi|84372668|gb|ABC56938.1| predicted dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosphaera
           stadtmanae DSM 3091]
          Length = 185

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 108/178 (60%), Gaps = 2/178 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I+ V I++   F D+RG+F +TY  ++    G+   FVQDN S S   G +RGLHFQR 
Sbjct: 10  SIDGVYIIEPTVFGDNRGYFMETYQKEVFSRAGISSEFVQDNQSKS-KKGVLRGLHFQRT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G +FD+AVD+R NS TYG WV + +S+ N  Q YIP GFAHGF+ L  
Sbjct: 69  Q-PQGKLVRVIKGEVFDVAVDLRSNSSTYGKWVGVILSSENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
             E  YK TD+Y  + + G+ W D++I I WPL D     +S+KD+    L + +  F
Sbjct: 128 EAEFTYKCTDYYKADDEDGIKWDDETIGIKWPLDDVDEIILSDKDKLWKSLEETNVDF 185


>gi|37523271|ref|NP_926648.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gloeobacter violaceus PCC
           7421]
 gi|35214275|dbj|BAC91643.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gloeobacter violaceus PCC
           7421]
          Length = 186

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 106/171 (61%), Gaps = 5/171 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++ + F D+RG+F ++Y      ELG+ D FVQDN S S   G +RGLH+Q   + Q
Sbjct: 11  VYVIEPKVFGDARGYFYESYHRAKFAELGIPDEFVQDNCSRSAR-GVLRGLHYQLR-FPQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKL R + G +FD+AVDIR+ SPT+G W  + +SA N  QIY+P GFAHGF  L  + E 
Sbjct: 69  AKLCRVVEGEVFDVAVDIRKGSPTFGQWAGVVLSAENRHQIYVPAGFAHGFAVLSESAEF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           +YK +DFY  E + GV W D  I I WP+   +L   S KDQ    LNQ D
Sbjct: 129 LYKCSDFYHPEDEQGVLWNDPDIGIPWPVEAPVL---SGKDQKYLPLNQTD 176


>gi|332705308|ref|ZP_08425386.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lyngbya majuscula 3L]
 gi|332355668|gb|EGJ35130.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lyngbya majuscula 3L]
          Length = 181

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 113/168 (67%), Gaps = 7/168 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I  V IL+ R F D RG+F ++Y+ ++L +  G+   FVQDN+S S   G +RGLH+Q 
Sbjct: 7   KIPEVLILEPRVFGDDRGFFFESYNKRVLADKAGITAEFVQDNYSRSAQ-GVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR + G IFD+AVDIR++SPT+G WVS  +SA N  QI+IP GFAHGF+ +
Sbjct: 66  QQP--QGKLVRVLLGTIFDVAVDIRKSSPTFGQWVSCLLSAENKQQIWIPAGFAHGFLVV 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
               EV+YK TDFY+ +H+  + W D  + I WPL D+  PS+S KDQ
Sbjct: 124 SEFAEVLYKTTDFYAPDHERTIVWNDPDLAIHWPLTDS--PSLSAKDQ 169


>gi|150020961|ref|YP_001306315.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosipho melanesiensis
           BI429]
 gi|149793482|gb|ABR30930.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosipho melanesiensis
           BI429]
          Length = 190

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 110/174 (63%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I+K   + DSRG+F ++++ K   E+GL   FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IEGLYIIKPTVYGDSRGFFMESWNRKEFAEIGLDMDFVQDNHSKS-KKGVLRGLHFQEK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR + G ++D+AVD+R++SPT+G +  + +S  N L  YIP GFAHGF+ L   
Sbjct: 69  YPQGKLVRVVKGVVYDVAVDLRKDSPTFGKYYGVILSEENKLMFYIPEGFAHGFLVLSDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL--PSVSEKDQNLPFLNQ 174
              +YK T++Y  E+DSG+ W D  I I WP  +  +  P +SEKD+ LP L +
Sbjct: 129 VHFLYKATEYYYPEYDSGIIWNDPDIAIKWPFEEYRIEYPILSEKDKKLPTLRE 182


>gi|330446536|ref|ZP_08310188.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328490727|dbj|GAA04685.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 180

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 110/174 (63%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I++ +   D RG++S+ YS + L + G+    VQDNH  S   GT+R +HFQ  P
Sbjct: 8   LDGVLIIEPKIHRDDRGYYSEIYSERSLSDKGISFRAVQDNHIKS-KKGTLRAIHFQNNP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQAKLVRC  G++ D  VD+R++SPT+  W+ +E++  N LQ+ IP+GF HG + LE +
Sbjct: 67  KAQAKLVRCTKGKVHDFIVDLRKDSPTFKKWIMVELNTENNLQVLIPSGFGHGVLALEDD 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           TEV+YKV + Y  EHD  + W D  ++I W +     P +SEKD+  P+L   D
Sbjct: 127 TEVMYKVDELYYPEHDRAIFWADPELNIEWGIES---PLLSEKDKTAPYLKDSD 177


>gi|93115449|gb|ABE98411.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|203285011|gb|ACH97130.1| RmlC [Escherichia coli]
 gi|203285023|gb|ACH97141.1| RmlC [Escherichia coli]
          Length = 180

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 109/168 (64%), Gaps = 4/168 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ +  +E+ G +  FVQDNHS S   G +RGLH+Q PP+A
Sbjct: 11  VLIFEPKVFGDERGFFMESFNQRQFEEIVGRKISFVQDNHSKS-KKGVLRGLHYQLPPFA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCI G ++D+AVD+R  S  YG WV + +SA N  Q++IP GFAHGF+ +    E
Sbjct: 70  QGKLVRCINGEVYDVAVDLRPESINYGKWVGIILSAENKKQLWIPEGFAHGFLVISEFAE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
             YK T++YS E + G+ W D +I+I WP +   L  +S KD   PF+
Sbjct: 130 FAYKTTNYYSKESERGIRWNDPTINIQWPKMGQYL--LSPKDALAPFI 175


>gi|326798979|ref|YP_004316798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingobacterium sp. 21]
 gi|326549743|gb|ADZ78128.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingobacterium sp. 21]
          Length = 182

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ + +ED+RG F +TY+  L +E G+ + FVQDN S S   G +RGLH Q  P
Sbjct: 8   IEGVVIIEPKIWEDNRGQFFETYNEALFRENGIDEKFVQDNQSVSCK-GALRGLHAQAGP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR I G + D+AVDIR+NSPT+G    +E+S  N   ++IP GF HGF+ LE N
Sbjct: 67  HAQGKLVRVIKGSVIDVAVDIRKNSPTFGQTFHIELSEANAKMLWIPVGFLHGFVALEEN 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           T   YKVT  Y   ++ GV + D + +I WPL    L  +S+KD  LP L  I++PF
Sbjct: 127 TIFCYKVTGKYDKANEIGVRYNDPTFNIQWPLPQEEL-ILSDKDLQLPLLADINNPF 182


>gi|297205907|ref|ZP_06923302.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus jensenii
           JV-V16]
 gi|297149033|gb|EFH29331.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus jensenii
           JV-V16]
          Length = 193

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (60%), Gaps = 5/183 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  V+I+    F D RG+F++TYS +  K  G+   F+QDN S S   G +RGLHFQR 
Sbjct: 10  NLQDVKIITPAVFGDHRGFFTETYSDRDFKAAGINFNFIQDNQSLSTQAGVLRGLHFQRG 69

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R   G + D+ VD+R+ SPTY  W    +S +N  Q+ +P GFAHGF+TL  
Sbjct: 70  KAAQTKLIRVATGAVLDVIVDLRKGSPTYKQWEGYILSESNHRQLLVPRGFAHGFVTLTD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSP 178
           N   +YK  ++Y+ E D G++++   ++I WP+ LD  +   SEKD N P L +   D+P
Sbjct: 130 NVNFLYKCDNYYNAEADGGISFKTPELNIDWPIDLDKAI--TSEKDANQPTLTEFEKDNP 187

Query: 179 FEY 181
           F Y
Sbjct: 188 FVY 190


>gi|163846788|ref|YP_001634832.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222524606|ref|YP_002569077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus sp. Y-400-fl]
 gi|163668077|gb|ABY34443.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222448485|gb|ACM52751.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chloroflexus sp. Y-400-fl]
          Length = 176

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 109/172 (63%), Gaps = 3/172 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +    I++    ED+RG+F++ ++     E GL D  VQ N S++   GT+RG+HFQ  
Sbjct: 7   ELKDAHIIELEPREDNRGFFARVWAKDEFAEHGLVDRVVQMNLSYNRVAGTLRGMHFQHA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYA+ KLVRCI G I+D+ +D+R +SPTY  W+ ++++A N L +Y+P GFAHGF TLE 
Sbjct: 67  PYAETKLVRCIRGAIYDVIIDLRPDSPTYKRWIGVKLTAANRLALYVPEGFAHGFQTLED 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           +TEV Y+V+ +Y+   + GV + D +  I WPL  T    +SEKD+  P   
Sbjct: 127 DTEVFYQVSQYYTPSAEGGVRYDDPAFGIEWPLPVT---EMSEKDKRWPLFT 175


>gi|330961714|gb|EGH61974.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 181

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 114/170 (67%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKTFGDDRGFFFESFNQKAFEEVVGRSVKFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR  AG +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTAGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D +++I WPL D   PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDPTVNIEWPLSDA--PSLSVKDQK 170


>gi|9957832|gb|AAG09512.1|AF279618_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 182

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+   F D RG+F ++++ ++ + L  ++  FVQDNHS S     +RGLH+Q  
Sbjct: 8   IPDVFILEPLVFVDERGFFMESFNHRVFETLLDIKVNFVQDNHSKSTK-NVVRGLHYQTE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRCI+G ++D+AVD+R  S TYGCWV +E+SA N  Q++IP GFAHGF+TL  
Sbjct: 67  PYAQGKLVRCISGAVYDVAVDLRSTSQTYGCWVGVELSALNMRQLWIPEGFAHGFLTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           N E +YK T++Y+ E +  + + D  +DI WP+ +     VS+KD+
Sbjct: 127 NVEFLYKTTNYYNKESERCIRYNDPDLDIIWPISNKDNIIVSDKDK 172


>gi|167038025|ref|YP_001665603.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116438|ref|YP_004186597.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856859|gb|ABY95267.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929529|gb|ADV80214.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 183

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 107/173 (61%), Gaps = 2/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++T  FED+RG+F ++Y+    K  GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGLYIIETGIFEDNRGYFMESYNYNDFKVAGLDMVFVQDNQSKS-KRGVLRGLHFQKK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR + G +FD+AVD+R+NS TYG WV + +S  N  Q YIP GFAHGF+ L   
Sbjct: 69  HPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSEENKKQFYIPEGFAHGFLVLSEE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            E  YK T+FY  + + G+ W D  I+I WPL       +SEKD+  P L  +
Sbjct: 129 AEFFYKCTNFYYPDDEGGIIWNDPDINIQWPLDGIEEIILSEKDKKWPRLKDL 181


>gi|225386850|ref|ZP_03756614.1| hypothetical protein CLOSTASPAR_00598 [Clostridium asparagiforme
           DSM 15981]
 gi|225047047|gb|EEG57293.1| hypothetical protein CLOSTASPAR_00598 [Clostridium asparagiforme
           DSM 15981]
          Length = 185

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++   F+D RG+F +TY+    +E GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 12  IEGLYVIEPTVFKDERGYFVETYNQNDFREAGLNMVFVQDNQSMSVK-GVLRGLHFQKQ- 69

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR I G +FD+AVD+R +S TYG W  + +SA N  Q YIP GFAHGF+ L   
Sbjct: 70  YPQGKLVRAIRGTVFDVAVDLRSDSGTYGKWFGVTLSAENKKQFYIPEGFAHGFLVLSDE 129

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E  YK TDFY    + G+ W D  I + WP+ + +   +SEKDQ 
Sbjct: 130 AEFAYKCTDFYHPGDEGGLLWSDPEIGVEWPIEEGMELIISEKDQK 175


>gi|226943712|ref|YP_002798785.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Azotobacter vinelandii DJ]
 gi|226718639|gb|ACO77810.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Azotobacter vinelandii DJ]
          Length = 182

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 114/173 (65%), Gaps = 4/173 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           ++I+ + + + + F D RG+F ++Y+ +  ++ +G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LDISGLVLFEPKVFGDDRGFFFESYNQRHFEDAVGRAVNFVQDNHSRSAQ-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR + G +FD+AVDIR++SPT+G WV + +SA N  Q +IP GFAHGF+TL
Sbjct: 65  LPPHAQGKLVRVVQGEVFDVAVDIRKSSPTFGQWVGVLLSAENKRQFWIPEGFAHGFVTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
               E +YK TD+Y+ + +  + W D ++ I W  ++   P +S KDQ  P L
Sbjct: 125 SETAEFLYKTTDYYAPDSERSILWNDPALAIDWRGIEA--PLLSGKDQKAPLL 175


>gi|315299445|gb|EFU58696.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli MS 16-3]
          Length = 182

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 109/164 (66%), Gaps = 3/164 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S     +RG+H+Q     
Sbjct: 11  VLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKS-KINVLRGMHYQTQN-T 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR I+G ++D+AVD+R  S T+G WV +E+S NN  Q++IP GFAHGF  LE NTE
Sbjct: 69  QGKLVRVISGSVYDVAVDLREKSKTFGKWVGVELSGNNKRQLWIPEGFAHGFYVLEENTE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK TD Y+  H+  + W D +I+I+WP++    P +SEKD N
Sbjct: 129 FVYKCTDTYNPAHEHTLLWNDPTINISWPIIQNCKPIISEKDAN 172


>gi|325836661|ref|ZP_08166204.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Turicibacter sp. HGF1]
 gi|325491186|gb|EGC93474.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Turicibacter sp. HGF1]
          Length = 193

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 110/179 (61%), Gaps = 7/179 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ + F D RG+F ++YS K   E GL   FVQDN S S   G +RGLHFQ     Q K
Sbjct: 16  IIEPKVFGDERGYFMESYSQKDFTEAGLTMTFVQDNESKS-RKGVLRGLHFQTKQ-TQGK 73

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR   G ++D+AVD+R+ SPTYG W  + +SA N  Q Y+P GFAHGF+         Y
Sbjct: 74  LVRVTQGEVWDVAVDLRKGSPTYGQWEGVYLSAENKRQFYVPEGFAHGFVVTSEEAIFNY 133

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQI-DSPFEYDG 183
           K TDFY+ E+DSG+ W D+ + + WPL  L  IL  +SEKDQ    L ++ D PF Y+G
Sbjct: 134 KCTDFYAPEYDSGLLWNDEDVAVKWPLEGLGEIL--LSEKDQKQKTLKELKDLPFIYEG 190


>gi|29726031|gb|AAO88956.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
          Length = 175

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 111/166 (66%), Gaps = 4/166 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V+I++ + F D RG+F ++++ +  +  +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   KIPDVKIIEPKVFGDERGFFFESFNQQQFEAAVGYPVHFVQDNHSKSTK-GVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQAKLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 66  APHAQAKLVRCVVGEVFDVAVDIRKSSPTFGQWVGVHLSAENKRQLWIPEGFAHGFVTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              E +YK T++YS + +  + W D  + I WP+   +  + S+KD
Sbjct: 126 ETAEFLYKTTNYYSPQCEGAIRWDDSKVGIEWPVEGVV--NQSQKD 169


>gi|160935035|ref|ZP_02082421.1| hypothetical protein CLOLEP_03911 [Clostridium leptum DSM 753]
 gi|156866488|gb|EDO59860.1| hypothetical protein CLOLEP_03911 [Clostridium leptum DSM 753]
          Length = 189

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 109/182 (59%), Gaps = 2/182 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + +++ + F D+RG+F +TY+    K  GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  GIEGLVVVEPKVFGDNRGYFMETYNYNDFKAAGLDMVFVQDNQSKS-KKGVLRGLHFQKK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G ++D+AVD+RR S TYG W  + +SA N  Q Y+P GFAHGF+ +  
Sbjct: 69  N-PQGKLVRVVSGEVYDVAVDLRRGSDTYGKWYGVLLSAENKKQFYVPEGFAHGFVVMSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
             E +YK T FY    + G+ W D  I I WP+ +     +SEKDQ+   L   +SPF  
Sbjct: 128 TAEFVYKCTRFYDPSDEGGLMWNDPEIGIDWPVPENAELLLSEKDQHHQPLKDFESPFTM 187

Query: 182 DG 183
           +G
Sbjct: 188 EG 189


>gi|188991707|ref|YP_001903717.1| NDP-hexulose epimerase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167733467|emb|CAP51668.1| NDP-hexulose epimerase [Xanthomonas campestris pv. campestris]
          Length = 193

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 107/167 (64%), Gaps = 3/167 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++     D+RGWF++ + ++ + + GL D FVQ N+SF+ + GT+RG+H+Q PP  + K
Sbjct: 13  IIEPEPRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAEAGTLRGMHYQLPPAPEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           +VRCI G ++D  VD+R +SPTY  W  +E+SA+N L +Y+P GFAHGF+TL+  TE +Y
Sbjct: 73  IVRCIRGALWDAIVDLRPDSPTYLQWYGVELSADNRLALYVPRGFAHGFITLQAQTEALY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             +  Y+   + G+ W D  I I WP    +L   S+KD   P  N+
Sbjct: 133 FASAMYTPAAERGLRWDDARIGIRWPCTPALL---SDKDAAWPEFNE 176


>gi|300853758|ref|YP_003778742.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium ljungdahlii DSM
           13528]
 gi|300433873|gb|ADK13640.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium ljungdahlii DSM
           13528]
          Length = 191

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 110/174 (63%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++T  F D+RG+F +TY+    K +GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 14  IEGVYIIETGIFGDNRGYFMETYNYSDFKAVGLDMVFVQDNQSKS-KKGVLRGLHFQKN- 71

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q KLVR + G++FD+AVD+R  S TYG W+ + +S  N  Q YIP GFAHGF+ +   
Sbjct: 72  YSQGKLVRVVKGKVFDVAVDLRDGSSTYGKWIGVTLSEENRKQFYIPKGFAHGFLVISDE 131

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQ 174
            E  YK T+FY  E + G+ W D  I+I WPL  +D I+   SE+D+  P L +
Sbjct: 132 AEFCYKCTEFYHPEDEGGIIWNDPDINIKWPLEGIDNII--FSERDKLWPTLKE 183


>gi|226323946|ref|ZP_03799464.1| hypothetical protein COPCOM_01723 [Coprococcus comes ATCC 27758]
 gi|225207495|gb|EEG89849.1| hypothetical protein COPCOM_01723 [Coprococcus comes ATCC 27758]
          Length = 190

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 101/159 (63%), Gaps = 3/159 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F +TY+ K ++E GL   FVQDN S S     +RGLHFQ+  Y Q KLVR I G 
Sbjct: 35  DQRGYFMETYNQKDMEEAGLTMKFVQDNQSGSGKA-VLRGLHFQKK-YPQGKLVRVIRGT 92

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVDIR+ S TYG W  +E+S  N  Q YIP GFAHGF+ L    E  YK TDFY  
Sbjct: 93  VFDVAVDIRKGSATYGKWYGIELSEENKKQFYIPEGFAHGFLVLSDQAEFCYKCTDFYHP 152

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           + + G+AW D +I++ WP LD +   +SEKD+    L +
Sbjct: 153 DDEGGIAWNDPTINVAWPELD-VPYRMSEKDKKWGRLGE 190


>gi|169836770|ref|ZP_02869958.1| dTDP-4-dehydrorhamnose 3,5-epimerase [candidate division TM7
           single-cell isolate TM7a]
          Length = 168

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (67%), Gaps = 2/152 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F D RG+F +TY+ K  +ELGL   FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IKDLVIIEPKVFGDERGFFMETYNQKSFEELGLTMNFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLV  I G ++D+AVD+R+ S T+G W ++++S+ N L  YIP GFAHGF+TLE  
Sbjct: 69  HTQGKLVCVIKGSVYDVAVDLRKGSKTFGKWYAVKLSSENKLMFYIPEGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
           TE  YK TD Y+ E+DSG+ W D++I+I W  
Sbjct: 129 TEFTYKCTDLYAPEYDSGILWNDETINIDWKF 160


>gi|125973881|ref|YP_001037791.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium thermocellum ATCC
           27405]
 gi|125714106|gb|ABN52598.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium thermocellum ATCC
           27405]
 gi|316939921|gb|ADU73955.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium thermocellum DSM
           1313]
          Length = 183

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 112/168 (66%), Gaps = 3/168 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + F D+RG+F ++Y+ K   E GL   FVQDNH  S   G +RG+HFQR  
Sbjct: 11  IEGLVVVEPKVFTDTRGFFFESYNKKAFCEFGLTMEFVQDNHIKS-RIGVLRGIHFQRK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q +LVR I G+++D+AVD+R+NSPT+G W  +E+SA N    YIP  F H F+TLE +
Sbjct: 69  FPQGRLVRVIKGKVYDVAVDLRKNSPTFGKWYGIELSAENKKMFYIPENFGHAFLTLEDD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
           TEV+ K T+ Y  E +SG+ + D  ++I WP ++  +  +SEKD+NLP
Sbjct: 129 TEVLCKTTNVYRPEFESGIIYNDPELNIDWPQIEGDI-VLSEKDKNLP 175


>gi|254458145|ref|ZP_05071571.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Campylobacterales bacterium
           GD 1]
 gi|207084981|gb|EDZ62267.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Campylobacterales bacterium
           GD 1]
          Length = 191

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 112/167 (67%), Gaps = 3/167 (1%)

Query: 16  DSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           D+RG+F +T+    L+E LG +  F QDN S S   G +RGLH+Q PPY+Q KL+R I G
Sbjct: 21  DTRGYFVETFRQDKLEEFLGFKINFCQDNESKS-SKGVLRGLHYQLPPYSQTKLLRVIQG 79

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
           R+ DIAVDIR++SPT+G  VS+E++A N  Q+ IP GFAHGF+ LE +T   YKV ++YS
Sbjct: 80  RVLDIAVDIRKDSPTFGEHVSIELTAENKKQLLIPHGFAHGFVVLEDDTIFAYKVDNYYS 139

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E+D G+A+ D  + I W  +D  L ++S+KD   P L   +  FEY
Sbjct: 140 PENDRGIAFDDPDLGIDWQ-VDFSLLNLSQKDTKQPRLKATNDLFEY 185


>gi|74317796|ref|YP_315536.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057291|gb|AAZ97731.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thiobacillus denitrificans
           ATCC 25259]
          Length = 180

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 110/172 (63%), Gaps = 6/172 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPYA 64
           V +L+ + F D+RG+F ++++ K    LGL   FVQDNHS S   G +RGLH+Q + P  
Sbjct: 11  VLLLEPKVFGDARGFFLESWNRKTFSALGLDVDFVQDNHSRS-ARGVLRGLHYQIKDP-- 67

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVD+RR SP +G WV  E+SA N   ++IP GFAHGF+ L  + +
Sbjct: 68  QGKLVRVVNGSVFDVAVDLRRASPNFGRWVGYELSAENQRMLWIPPGFAHGFLVLSESAD 127

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK T +Y+ E D GV W D  I I WP   +  P++S KDQ LPFL   +
Sbjct: 128 FLYKTTAYYAPEWDRGVCWNDPEIGIEWPWSGS--PTLSAKDQVLPFLKDAE 177


>gi|269121010|ref|YP_003309187.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sebaldella termitidis ATCC
           33386]
 gi|268614888|gb|ACZ09256.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sebaldella termitidis ATCC
           33386]
          Length = 189

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 112/171 (65%), Gaps = 6/171 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++   FED RG+F ++Y+    ++LGL+  F+QDNHS S   G +RGLH+Q   
Sbjct: 11  IADLVIIEPLVFEDERGFFLESYNKNHFEKLGLKMEFIQDNHSKS-KKGVLRGLHYQ-SK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           ++Q KLVR   G ++D+AVD+R  SPT+G W  LE++  N    Y+P GFAHGF+TLE  
Sbjct: 69  HSQGKLVRVTKGAVWDVAVDLRTESPTFGKWYGLELNEKNKKMFYVPEGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD-TILPS---VSEKDQNL 169
           TE  YK TDFY  E+DSG+ W D  + I WP+ D  IL +   +S+KD+NL
Sbjct: 129 TEFQYKCTDFYYPEYDSGIFWNDDILKIEWPISDYGILINELVISDKDKNL 179


>gi|311278965|ref|YP_003941196.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterobacter cloacae SCF1]
 gi|308748160|gb|ADO47912.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterobacter cloacae SCF1]
          Length = 184

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 108/169 (63%), Gaps = 5/169 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL---GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +  V+I++   F D RG+F +T++ K  +EL   G+   FVQDNHS S   G +RGLHFQ
Sbjct: 8   LEEVKIIEPTVFGDDRGFFMETWNQKKFEELVTNGVSTKFVQDNHSKS-KKGILRGLHFQ 66

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR   G +FD+AVD+R+NSPT G WV +E+SA N  Q+++P GFAHGF  L
Sbjct: 67  SE-NTQGKLVRVGVGAVFDVAVDVRKNSPTLGKWVGVELSAENKRQLWVPEGFAHGFYVL 125

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E IYK TDFY+ + +  + W D +I + WPL +T+   +SEKD N
Sbjct: 126 SDTAEFIYKCTDFYNPKAEHSIIWNDPAIGVDWPLDETVPLILSEKDMN 174


>gi|257468057|ref|ZP_05632153.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium ulcerans ATCC
           49185]
 gi|317062343|ref|ZP_07926828.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688019|gb|EFS24854.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium ulcerans ATCC
           49185]
          Length = 475

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 110/171 (64%), Gaps = 6/171 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +N+  + I++   FEDSRG+F ++Y+    +++G+   F+QDNHS S   GT+RGLHFQ 
Sbjct: 9   INLQGIYIIEPLVFEDSRGFFLESYNKAEFEKIGITTNFIQDNHSKS-KKGTLRGLHFQ- 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             ++QAKL+R I G+I DI VDIR+ S TYG W   E+SA N   +YI  GFAHGF+ LE
Sbjct: 67  IKHSQAKLIRVIKGKILDIVVDIRKGSSTYGKWCGTELSAENRKMLYIAKGFAHGFLALE 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQ 167
            +TE+ YK  ++Y+  +DSG+ W DK I I W      L      +SEKD+
Sbjct: 127 DDTEIEYKCDEYYAPHYDSGIMWNDKDIAIDWNFEKNGLKEENIILSEKDK 177


>gi|281418043|ref|ZP_06249063.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium thermocellum
           JW20]
 gi|281409445|gb|EFB39703.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium thermocellum
           JW20]
          Length = 183

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 112/168 (66%), Gaps = 3/168 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + F D+RG+F ++Y+ K   E GL   FVQDNH  S   G +RG+HFQR  
Sbjct: 11  IEGLVVVEPKIFTDTRGFFFESYNKKAFCEFGLTMEFVQDNHIKS-RIGVLRGIHFQRK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q +LVR I G+++D+AVD+R+NSPT+G W  +E+SA N    YIP  F H F+TLE +
Sbjct: 69  FPQGRLVRVIKGKVYDVAVDLRKNSPTFGKWYGIELSAENKKMFYIPENFGHAFLTLEDD 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
           TEV+ K T+ Y  E +SG+ + D  ++I WP ++  +  +SEKD+NLP
Sbjct: 129 TEVLCKTTNVYRPEFESGIIYNDPELNIDWPQIEGDI-VLSEKDKNLP 175


>gi|260856021|ref|YP_003229912.1| putative dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli
           O26:H11 str. 11368]
 gi|24417733|gb|AAN60457.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|56800699|gb|AAW31113.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|77737732|gb|ABB01684.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|257754670|dbj|BAI26172.1| predicted dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli
           O26:H11 str. 11368]
          Length = 180

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 5/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E +YK T++Y  E +  + W D  + I WP       ++SEKD+ 
Sbjct: 127 IAEFVYKTTNYYHPESEGCIKWDDSFLMIDWPNKPI---AISEKDKK 170


>gi|325281623|ref|YP_004254165.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Odoribacter splanchnicus DSM
           20712]
 gi|324313432|gb|ADY33985.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Odoribacter splanchnicus DSM
           20712]
          Length = 190

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 113/183 (61%), Gaps = 8/183 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQRP 61
           I  V I++ R F D RG+F +++S +  +    + VFVQDN S S  C G +RGLHFQ+P
Sbjct: 8   IPGVVIVQPRIFGDERGYFFESFSQRDFERQVCKTVFVQDNESKS--CYGVVRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ+KLVR + GR+ D+AVDIR+ SPT+G +VS+E++  N  Q +IP GFAHGF  L  
Sbjct: 66  PYAQSKLVRVVKGRVLDVAVDIRKGSPTFGKYVSVELTEENKRQFFIPRGFAHGFAVLST 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ E +  +AW D  + I W  P    IL   SEKD++ P L      F
Sbjct: 126 EAVFQYKCDNFYAPESEGALAWDDPDLGIDWRIPAAKVIL---SEKDRHHPCLKDACDWF 182

Query: 180 EYD 182
           +Y+
Sbjct: 183 DYN 185


>gi|312136509|ref|YP_004003846.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Methanothermus fervidus DSM
           2088]
 gi|311224228|gb|ADP77084.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermus fervidus DSM
           2088]
          Length = 185

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 102/161 (63%), Gaps = 2/161 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++K + FED RG+F +TY++K  K+  +   FVQDN SFS   G +RGLHFQ     Q K
Sbjct: 16  VIKPKVFEDERGYFMETYNAKEFKKANINAKFVQDNQSFS-KKGVLRGLHFQYRR-QQGK 73

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR I G+IFD+AVD+R+NS TYG W S+ +S  N    YIP GFAHGF+ L     V Y
Sbjct: 74  LVRVIKGKIFDVAVDLRKNSETYGEWESVILSGKNKKMFYIPEGFAHGFLVLSDTAIVTY 133

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           K TDFY  E++ G+ W D  I I WP+ +     +S+KD+ 
Sbjct: 134 KCTDFYYPEYEGGIIWNDPDIGIEWPIDEVDKLIISDKDKK 174


>gi|241668047|ref|ZP_04755625.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254876582|ref|ZP_05249292.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254842603|gb|EET21017.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 190

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 115/181 (63%), Gaps = 3/181 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           NI  V I + +   D RG+F +T+   KL   LG +  F QDN S S   G +RGLH+Q 
Sbjct: 7   NIEGVVICEPKVHGDERGYFVETFREDKLFDFLGYKINFCQDNESKS-SYGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR I GR+ D+AVDIR+ SPT+G  V++E+SA+N  Q+ +P GFAHGF+ LE
Sbjct: 66  PPHAQTKLVRVIQGRVLDVAVDIRKGSPTFGQHVAVELSADNKRQLLVPRGFAHGFVVLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T   YKV  +YS E D G+A+ D+SI I W +    L  +S KD+  P LN+    F+
Sbjct: 126 NDTIFSYKVDSYYSPECDRGIAFDDESIAINWQVPSDKL-KLSAKDKVQPKLNETVDLFD 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|167627477|ref|YP_001677977.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597478|gb|ABZ87476.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 190

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 114/181 (62%), Gaps = 3/181 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +IN + I +     D RG+F +T+   KL   LG +  F QDN S S   G +RGLH+Q 
Sbjct: 7   HINDIIICEPTVHSDDRGYFVETFRQDKLFDFLGYKINFCQDNESKS-SYGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVR I GR+ D+AVDIR+ SPT+G +V++E+SA N  QI IP GFAHGF+ LE
Sbjct: 66  APHAQTKLVRVIQGRVLDVAVDIRKGSPTFGQYVAVELSAENKKQILIPRGFAHGFVVLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T   YKV  +YS E D G+A+ DKSI I W +   +L  +S KD+  P L+     FE
Sbjct: 126 DDTVFAYKVDSYYSPECDRGIAFDDKSIAIDWQVPVDML-KLSAKDRGQPKLDDTVDLFE 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|28377962|ref|NP_784854.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum
           WCFS1]
 gi|28270796|emb|CAD63701.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus plantarum
           WCFS1]
          Length = 182

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 98/152 (64%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I++   F D RG+F++TYS +  KE G+   F+QDN S S + G +RGLHFQR  
Sbjct: 11  LQDVKIIEPAVFGDKRGFFTETYSDRDFKEAGIDFDFIQDNQSLSAEAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R  SPTYG W    IS +N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDVRAGSPTYGEWEGYIISESNHRQLLVPRGFAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
              +YK  ++Y+ E D G+ + DK ++I WP+
Sbjct: 131 VNFLYKCDNYYNAEADGGITFMDKDLNINWPI 162


>gi|60418017|dbj|BAD90657.1| polysaccharide synthesis enzyme [Acetobacter tropicalis]
          Length = 185

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 107/183 (58%), Gaps = 5/183 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++   +F D+RG+FS+TY+   +++ G+   FVQDN S S   G +RGLH Q 
Sbjct: 6   LAIPDVILVTPPRFGDNRGFFSETYNIDRMRDAGITQPFVQDNQSLSRQKGVVRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVRC  G I+D+A+D R  SPTYG WV+ E+S  N  Q++IP GF HGF TL 
Sbjct: 66  DPYAQGKLVRCTKGAIWDVAIDARTGSPTYGKWVAAELSEENWSQLWIPPGFLHGFCTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSP 178
            N EV YK T  Y+   +  V W    + I WP+   D IL   SEKD   P  +     
Sbjct: 126 ENAEVQYKCTGLYNKASERAVIWNSAELAIDWPVKPEDAIL---SEKDLEAPEFSAAKGW 182

Query: 179 FEY 181
           F++
Sbjct: 183 FQF 185


>gi|9957843|gb|AAG09521.1|AF279620_5 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
 gi|226290775|gb|ACO40474.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Dakar]
 gi|298353037|gb|ADI77016.1| RmlC [Salmonella enterica]
          Length = 183

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 113/167 (67%), Gaps = 5/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRP 61
           I+   I++   + D+RG+F ++Y+  + ++L  + + F QDN S S   G +RGLHFQ  
Sbjct: 8   IHEALIIEPIIYSDARGFFFESYNQLIFEDLIERKINFCQDNQSLSHK-GVLRGLHFQVN 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P AQ KLVRC+ G+I+D+ VD+R +SPTY  W    +SA+N  Q++IP G AHGF++LE 
Sbjct: 67  PKAQGKLVRCLHGKIYDVIVDLRVDSPTYKKWEGFVLSASNKKQLWIPEGCAHGFLSLED 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           NTE+ YK T++YS++H+  + W D S+ I WPL D I   +SEKD+N
Sbjct: 127 NTELAYKATEYYSLQHERCIRWNDPSLKIEWPLSDYI---ISEKDKN 170


>gi|257060586|ref|YP_003138474.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 8802]
 gi|256590752|gb|ACV01639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 8802]
          Length = 176

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 3/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +N   +++ ++ ED RG+F++++  K   + GL    VQ N SF+   GT+RG+H+Q  
Sbjct: 7   KLNGAYLIELKRLEDERGFFARSWCQKEFLDYGLDANLVQCNISFNLKKGTLRGMHYQIA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY + KL+RC  G I+D+ +D+  NS ++  W+ +E+SA N L IYIP GFAHGF TLE 
Sbjct: 67  PYEEVKLLRCTQGAIYDVIIDLNPNSSSFKQWIGVELSAENRLMIYIPKGFAHGFQTLED 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           +TEV Y++++FY  E   GV W D +  I WP+ D+I   +SEKD+ 
Sbjct: 127 HTEVFYQMSEFYHPECARGVRWNDPTFAIEWPIEDSI---ISEKDRQ 170


>gi|21231461|ref|NP_637378.1| strX protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768485|ref|YP_243247.1| strX protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|21113134|gb|AAM41302.1| strX protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573817|gb|AAY49227.1| strX protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 193

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 107/167 (64%), Gaps = 3/167 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++     D+RGWF++ + ++ + + GL D FVQ N+SF+ + GT+RG+H+Q PP  + K
Sbjct: 13  IIEPEPRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAEAGTLRGMHYQLPPAPEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           +VRCI G ++D  VD+R +SPTY  W  +E++A+N L +Y+P GFAHGF+TL+  TE +Y
Sbjct: 73  IVRCIRGALWDAIVDLRPDSPTYLQWYGVELTADNRLALYVPRGFAHGFITLQAQTEALY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             +  Y+   + G+ W D  I I WP    +   VS+KD   P  N+
Sbjct: 133 FASAMYTPAAERGLRWDDARIGIRWPCTPAL---VSDKDAAWPEFNE 176


>gi|266622170|ref|ZP_06115105.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium hathewayi DSM
           13479]
 gi|288866122|gb|EFC98420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium hathewayi DSM
           13479]
          Length = 184

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (61%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F DSRG+F +TY+    KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIKGLYVIEPTVFPDSRGYFMETYNQNDFKEAGLNMVFVQDNQSMSVK-GVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R +S TYG W  + +SA N  Q YIP GFAHGF+ L  
Sbjct: 69  -FPQGKLVRVVRGSVFDVAVDLRSDSETYGKWFGVLLSAENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  I I WP+ + +   +S+KDQ 
Sbjct: 128 EAEFAYKCTDFYHPGDEGGILWSDPEIGIDWPIEEGMELIISDKDQK 174


>gi|221213794|ref|ZP_03586768.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) (dTDP-L-rhamnose synthetase)
           [Burkholderia multivorans CGD1]
 gi|221166583|gb|EED99055.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) (dTDP-L-rhamnose synthetase)
           [Burkholderia multivorans CGD1]
          Length = 183

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 113/170 (66%), Gaps = 9/170 (5%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ--RPP 62
           V+I++ + F D+RG+F +++++K   E     V FVQDNHS S   G +RGLH+Q  RP 
Sbjct: 13  VKIIEPKVFGDARGFFFESFNAKEFVEYIEPGVEFVQDNHSRS-SKGVLRGLHYQLQRP- 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KL+R IAG + D++VDIRR+SPT+G WV++ +SA+N  Q+++P GFAHGF+ L   
Sbjct: 71  --QGKLLRVIAGEVLDVSVDIRRSSPTFGRWVAVNVSADNKRQVWVPRGFAHGFLVLSDY 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            EV+YK TD++  EH+  +AW D  + I WPL     PS+S KD   P L
Sbjct: 129 AEVLYKTTDYWYPEHERQIAWNDPELGIEWPL--DAPPSLSAKDAAAPLL 176


>gi|87123105|ref|ZP_01078956.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RS9917]
 gi|86168825|gb|EAQ70081.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RS9917]
          Length = 196

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 106/168 (63%), Gaps = 4/168 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLL-KELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +L  ++F D RGWF ++++ +     +G    FVQDNHS S   G +RGLH+Q P   QA
Sbjct: 19  LLTPQRFGDDRGWFFESWNQRRFDAAVGEHVAFVQDNHSRS-SQGVLRGLHYQLPAAPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   GRIFD+ VD+R +SP+ G W  +E+SA+N  Q+++P GFAHGF+TL    EV 
Sbjct: 78  KLVRASVGRIFDVVVDLRTSSPSNGQWAGVELSADNQQQLWVPEGFAHGFLTLSAVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFL 172
           YK   ++S E +  + W D ++ I+WPL  L+    S+SEKD   P L
Sbjct: 138 YKTRGYWSREQERAIRWDDPALAISWPLENLEGTAVSLSEKDAQAPTL 185


>gi|145588444|ref|YP_001155041.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046850|gb|ABP33477.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 184

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 109/167 (65%), Gaps = 3/167 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I+ V +++   F D RGWF++++++       GL   FVQDNHSFS    T+RGLH+Q  
Sbjct: 10  IHDVLVIEPTVFGDERGWFTESFNAVDFADATGLTVNFVQDNHSFSRQW-TLRGLHYQLE 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR +AG +FD+AVDIR+ SPTYG WV +E+SA N  Q+++P G AHGF+ L  
Sbjct: 69  K-TQGKLVRVVAGSVFDVAVDIRKESPTYGKWVGIELSAQNHKQLWVPPGLAHGFLVLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E +YK TD+Y  + ++ + W D ++ I WPL + + P+++ KD +
Sbjct: 128 TAEFLYKTTDYYHPQSEACLVWNDPTVAIAWPLPEGVNPNMNAKDMS 174


>gi|319957143|ref|YP_004168406.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Nitratifractor salsuginis DSM
           16511]
 gi|319419547|gb|ADV46657.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nitratifractor salsuginis DSM
           16511]
          Length = 191

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 116/181 (64%), Gaps = 3/181 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V I++ +   D RG+F +TY +  L+E LG +  F QDN S S   G +RGLH+Q 
Sbjct: 7   DIPDVIIVEPKIHGDERGYFVETYRADKLEEFLGYKINFCQDNESKS-SYGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ KLVR I G++ D+AVDIR++SPT+G +V++E+S  N  Q+ IP GFAHGF+ LE
Sbjct: 66  PPHAQTKLVRVIKGKVLDVAVDIRKSSPTFGQYVAVELSEENKKQLLIPRGFAHGFLVLE 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +T   YKV  +YS E D G+A+ D  I I W +    L  +S KD+  P L+  D  FE
Sbjct: 126 DDTVFAYKVDSYYSPECDRGIAFDDPEIGIDWRIPHDKL-ILSAKDKAQPKLSDTDDLFE 184

Query: 181 Y 181
           Y
Sbjct: 185 Y 185


>gi|71906878|ref|YP_284465.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dechloromonas aromatica RCB]
 gi|71846499|gb|AAZ45995.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dechloromonas aromatica RCB]
          Length = 177

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 105/163 (64%), Gaps = 2/163 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I++ R F D RG+F ++++ KL  + +G    FVQDNHS S     +RGLH+Q P
Sbjct: 8   IPDVLIIEPRVFGDDRGFFYESFNQKLFNDAVGCDVTFVQDNHSKSAK-NVLRGLHYQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P  Q KLVR + G +FD+AVDIR++SPTYG WV + +SA N  QI+IP G AHGF+TL  
Sbjct: 67  PKEQGKLVRVVQGEVFDVAVDIRKDSPTYGRWVGVTLSAENKKQIWIPQGLAHGFLTLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
             E +YK T++Y+ E +  + W D  ++I WP+    L SV +
Sbjct: 127 TAEFLYKTTEYYAPEAERCIRWNDSKLNIKWPIEGGALLSVKD 169


>gi|239628626|ref|ZP_04671657.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239518772|gb|EEQ58638.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 187

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 102/167 (61%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F D RG+F +TY+    +E GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 12  DIKGLYVIEPTVFRDERGYFVETYNQNDFREAGLDMVFVQDNQSMSVK-GVLRGLHFQKQ 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G +FD+AVD+R +S TYG W  + +SA N  Q YIP GFAHGF+ L  
Sbjct: 71  -YPQGKLVRAVRGTVFDVAVDLRSDSETYGKWFGVVLSAENKKQFYIPEGFAHGFLVLSD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  + + WP+ D +   +SEKD+ 
Sbjct: 130 EAEFAYKCTDFYHPGDEGGLKWDDPEVGVDWPVSDGMELIISEKDRK 176


>gi|256420555|ref|YP_003121208.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chitinophaga pinensis DSM
           2588]
 gi|256035463|gb|ACU59007.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chitinophaga pinensis DSM
           2588]
          Length = 188

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 6/177 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           + + R F D+RG+F ++YS +   + GLQ  FVQDN + S   G +RGLH+Q+ P+AQ K
Sbjct: 13  VYEPRVFNDNRGYFFESYSEQAFLQQGLQLKFVQDNQARS-TYGVLRGLHYQQEPHAQTK 71

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + GRI D+AVDIR+ SPTYG   ++E+SA N  Q+ +P GFAHG+  L    EV+Y
Sbjct: 72  LVRVLEGRIIDVAVDIRKGSPTYGKVFTIELSAENKKQLLVPKGFAHGYSVLSETAEVMY 131

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           KV +FY    + G+ + D +++I W   L D +   VSEKD  LP L      F Y+
Sbjct: 132 KVDNFYHKASEGGIIYNDPALNIDWGISLTDAL---VSEKDVILPTLENCTHNFVYN 185


>gi|9957858|gb|AAG09533.1|AF279623_4 dTDP-6-deoxy-D-glucose-3,5-epimerase [Salmonella enterica]
          Length = 182

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 110/163 (67%), Gaps = 2/163 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+   F + RG+F ++++ ++ + L    V FVQDNHS S     +RGLH+Q  PYA
Sbjct: 11  VFILEPLVFVNERGFFMESFNHRVFETLLDTKVNFVQDNHSKSTK-NVVRGLHYQTEPYA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVRCI+G ++D+AVD+R  S TYGCWV +E+SA N  Q++IP GFAHGF+TL  N E
Sbjct: 70  QGKLVRCISGAVYDVAVDLRSTSQTYGCWVGVELSALNMRQLWIPEGFAHGFLTLTDNVE 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            +YK T++Y+ E +  + + D  +DI WP+ +     VS+KD+
Sbjct: 130 FLYKTTNYYNKESERCIRYNDPDLDIIWPISNKDNIIVSDKDK 172


>gi|94497766|ref|ZP_01304333.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas sp. SKA58]
 gi|94422815|gb|EAT07849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas sp. SKA58]
          Length = 181

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 108/170 (63%), Gaps = 3/170 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ R F D RG+F ++Y++   K  GL   FVQDNHS S   G +RGLHFQ P   Q K
Sbjct: 13  IIEPRVFGDERGFFYESYNAGAFKAAGLDLNFVQDNHSKSAK-GVLRGLHFQNP-NPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR  AGR++D+AVDIRR+SP +G WV +E+SA N    ++P GFAHGF+ LE  TE +Y
Sbjct: 71  LVRVTAGRVWDVAVDIRRSSPHFGKWVGVELSAANKRMFWVPEGFAHGFIALEDGTEFLY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           K T  Y    +  + W D ++ I WP L+ + P +S KD     L++I++
Sbjct: 131 KCTATYDPSAEHSLMWNDPAVGIEWP-LEGLEPQLSGKDAQGKALSEIEA 179


>gi|325261283|ref|ZP_08128021.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. D5]
 gi|324032737|gb|EGB94014.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. D5]
          Length = 193

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 2/168 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++     DSRG+F +TY+   + E GL  VFVQDN S S   G +RGLHFQ   
Sbjct: 21  IEGLYVIEPTVHRDSRGYFIETYNQNDMHEAGLDLVFVQDNQSMS-TKGVLRGLHFQNQ- 78

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR I G ++D+AVD+R+NS TYG W  LE+S  N  Q YI  GFAHGF+ +   
Sbjct: 79  YPQGKLVRVIQGSVYDVAVDVRKNSKTYGQWFGLELSEENNKQFYISEGFAHGFLVMSDV 138

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
               +KVTDF+  +++ G+ W D +I + WPL     P +SEKD++ P
Sbjct: 139 ARFCFKVTDFWHPDNEIGIPWDDSAIGVEWPLKKGQEPIISEKDKHYP 186


>gi|253583524|ref|ZP_04860722.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Fusobacterium varium ATCC
           27725]
 gi|251834096|gb|EES62659.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Fusobacterium varium ATCC
           27725]
          Length = 475

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 9/176 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           N+  + I++   F D RG+F ++Y+    +++G+ + FVQDNHS S   G +RGLHFQ  
Sbjct: 10  NLQGIYIIEPLVFGDDRGFFLESYNKSEFEKIGIFEEFVQDNHSKS-KKGVLRGLHFQ-T 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            ++QAKL+R I G+IFDI VDIR++S TYG W   E+SA N   +YI  GFAHGF+ LE 
Sbjct: 68  RHSQAKLIRVIKGKIFDIVVDIRKSSFTYGKWCGTELSAENKKMLYISKGFAHGFLALED 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-------LDTILPSVSEKDQNLP 170
           +TE+ YK  +FY+ ++DSG+ W DK I+I W          D IL    +K Q+  
Sbjct: 128 DTEIEYKCDEFYNAQYDSGIMWNDKDININWNFEKYGIKEEDIILSEKDKKHQSFK 183


>gi|146298097|ref|YP_001192688.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Flavobacterium johnsoniae
           UW101]
 gi|146152515|gb|ABQ03369.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Flavobacterium johnsoniae
           UW101]
          Length = 182

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (62%), Gaps = 2/177 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++   F D RG+F ++YS    ++L +   FVQDN SFS   GT+RGLH+Q PP
Sbjct: 8   IKDLLIVEPTIFGDERGYFFESYSKTKFEDLDIHIDFVQDNQSFS-KRGTLRGLHYQNPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR + G I D+AVD+R++S TYG   S+ +S+ N  Q+ +P GFAHGF  +   
Sbjct: 67  FAQTKLVRVLEGEIIDVAVDLRKDSATYGKVFSVLLSSENKKQLLVPQGFAHGFSVISET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
             V+YK   FY+   + G+ + D S++I W  +D     VSEKDQ LPFL+  +S F
Sbjct: 127 ASVMYKCDQFYNKASEGGIRFDDSSLNIDWG-MDLKDAIVSEKDQKLPFLDNCNSLF 182


>gi|330834783|ref|YP_004409511.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Metallosphaera cuprina Ar-4]
 gi|329566922|gb|AEB95027.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Metallosphaera cuprina Ar-4]
          Length = 185

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 114/182 (62%), Gaps = 8/182 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           M I  V ++ +++F DSRG+F + Y     K   +   F Q NHSFS   G +RGLHFQ 
Sbjct: 8   MEIPEVVLIISKQFSDSRGYFEELYKESDFKNY-VPCNFPQINHSFS-KKGVLRGLHFQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLV  I G+IFD+ VD+R  SPTY  WVS+E++   G  ++IP GF HGF  LE
Sbjct: 66  NPYAQGKLVTVIFGKIFDVGVDLRVGSPTYKKWVSVELTP--GKLLWIPAGFTHGFYALE 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             + VIY VT  +S +HDSG+ W D  I++ WP  D   P +S+KD+NLP L +  + F+
Sbjct: 124 -ESHVIYMVTKEFSKDHDSGIIWNDDEINVKWPAND---PMLSDKDRNLPRLRESKANFK 179

Query: 181 YD 182
           Y+
Sbjct: 180 YN 181


>gi|312898304|ref|ZP_07757694.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Megasphaera micronuciformis
           F0359]
 gi|310620223|gb|EFQ03793.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Megasphaera micronuciformis
           F0359]
          Length = 192

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 111/174 (63%), Gaps = 3/174 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ + F D RG+F ++++ + ++  GL   FVQDNHS S   GT+RG+HFQ    AQAK
Sbjct: 15  IIEPQVFGDHRGFFMESWNKRTMETAGLFYNFVQDNHSSSTVKGTLRGIHFQYGDKAQAK 74

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVRC+ G + D+AVD+R++SPTY  W  +E+S  N  Q  IP GF HGF+TL  +   +Y
Sbjct: 75  LVRCVRGAVLDVAVDLRKDSPTYKQWYGIELSEENQKQFLIPRGFGHGFVTLTDHVGFMY 134

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           K  ++Y+ + D G+ W D ++ I W + + IL   SEKD   PF +++++   +
Sbjct: 135 KADNYYAPDADGGIRWNDPTLAINWGIENPIL---SEKDNKSPFFDELENKISF 185


>gi|282891818|ref|ZP_06300298.1| hypothetical protein pah_c198o003 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498251|gb|EFB40590.1| hypothetical protein pah_c198o003 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 185

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 107/163 (65%), Gaps = 3/163 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++   K  D RG+F++ +  K   + GL+   VQ N+S+S + GT+RGLH+Q PP+ + K
Sbjct: 13  LIDLNKLGDERGFFARLFCQKEFTQQGLEPAVVQVNNSYSVEKGTLRGLHYQLPPFEETK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVRCI G ++D+ VD+R +SPT+       +SA N L +Y+P GFAHGFMTL+ N+E++Y
Sbjct: 73  LVRCIQGSLYDVIVDLRVDSPTFKKSFGAVLSAENRLMMYVPKGFAHGFMTLQPNSEIMY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            V+ FYS E + GV W D +  I WP+  ++   +SE+D+  P
Sbjct: 133 FVSQFYSKECERGVRWDDPTFSIEWPVKPSL---ISERDKMHP 172


>gi|18309599|ref|NP_561533.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens str.
           13]
 gi|18144276|dbj|BAB80323.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium perfringens str.
           13]
          Length = 160

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (62%), Gaps = 2/161 (1%)

Query: 23  QTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVD 82
           +TYS K  +E GL   FVQDN S S   G +RGLHFQ   + Q KLVR   G ++D+AVD
Sbjct: 2   ETYSQKAFEEAGLTMKFVQDNESKS-KKGVLRGLHFQ-TKHTQGKLVRVTQGEVWDVAVD 59

Query: 83  IRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVA 142
           +R+ SPT+G W  + +SA N  Q Y+P GFAHGF+ L       YK TDFY+ E+DSG+ 
Sbjct: 60  LRKGSPTFGQWEGVHLSAENKRQFYVPEGFAHGFVVLSDEAVFNYKCTDFYAPEYDSGLL 119

Query: 143 WQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           W DK +++ WPL       +SEKD+    L ++D PF Y+G
Sbjct: 120 WNDKYVNVEWPLEGIEEIILSEKDKKQKTLKELDIPFIYEG 160


>gi|260495066|ref|ZP_05815195.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 3_1_33]
 gi|260197509|gb|EEW95027.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 3_1_33]
          Length = 164

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 105/154 (68%), Gaps = 6/154 (3%)

Query: 23  QTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVD 82
           ++Y+    KELG++++FVQDNHS S   G +RGLHFQ+  Y+QAKLVR + G + DIA+D
Sbjct: 2   ESYNYNTFKELGIENIFVQDNHSKSLK-GVLRGLHFQKGEYSQAKLVRVLKGAVLDIAID 60

Query: 83  IRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVA 142
           +R+NS T+G +V++E+S  N    +IP  FAHGF+TLE NTE+ YK  +FY+ + ++G+ 
Sbjct: 61  LRKNSKTFGKYVTVELSEKNKKMFFIPRNFAHGFLTLEDNTEIFYKCDNFYNPKSEAGIM 120

Query: 143 WQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
           W DK ++I W      +      +SEKD +N+ F
Sbjct: 121 WNDKDLNIEWNFKKYGINENELIISEKDKKNMSF 154


>gi|329569822|gb|EGG51581.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Enterococcus faecalis TX1467]
          Length = 175

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 105/173 (60%), Gaps = 9/173 (5%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           F + RG+F+++YS     E GL   FVQDNHS S + G +RGLHFQ+   AQ KL+R + 
Sbjct: 4   FGNHRGFFTESYSKAKFAEHGLDFDFVQDNHSLSTEAGVLRGLHFQKGEAAQTKLIRVVT 63

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G + D+ VDIR+ SPTYG W    +S +N  Q+ +P GFAHGF+TL  N   +YK  ++Y
Sbjct: 64  GAVLDVIVDIRKGSPTYGQWEGYILSEHNHRQLLVPKGFAHGFVTLTPNVNFMYKCDNYY 123

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQNLPFLNQIDS--PFEY 181
           +   D G+A+ D ++ I WP    I P     SEKDQ  P L + ++  PF Y
Sbjct: 124 NAAADGGIAFNDPALAIDWP----IAPEKAITSEKDQKHPTLKEFEAENPFIY 172


>gi|28868292|ref|NP_790911.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28851529|gb|AAO54606.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|331019588|gb|EGH99644.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 181

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 112/170 (65%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKTFGDDRGFFFESFNQKAFEEVVGRSVKFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFIV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D ++ I WP  +T  PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDATVGIEWPFSET--PSLSAKDQK 170


>gi|227891399|ref|ZP_04009204.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius ATCC
           11741]
 gi|301299657|ref|ZP_07205914.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|227866788|gb|EEJ74209.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius ATCC
           11741]
 gi|300215157|gb|ADJ79573.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius CECT
           5713]
 gi|300852751|gb|EFK80378.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 193

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 111/182 (60%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+++    F D+RG+F+++YS +  K  G+   F+QDNHS S   G +RGLHFQR  
Sbjct: 11  LQDVKLITPAVFGDNRGFFTESYSDRDFKAAGIDFDFIQDNHSLSTQAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R   G + D+ VD+R+ SPTY  W    +S +N  Q+ +P G+AHGF+TL  N
Sbjct: 71  AAQTKLIRVATGAVLDVIVDLRKGSPTYKQWEGYILSESNHRQLLVPKGYAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSPF 179
              +YK  ++Y  E D G++++   ++I WP+ LD  +   SEKD N P L +   D+PF
Sbjct: 131 VNFLYKCDNYYDAEADGGISFKTPELNIDWPIDLDKAI--TSEKDANQPTLTEFEKDNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|149195145|ref|ZP_01872236.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caminibacter mediatlanticus
           TB-2]
 gi|149134697|gb|EDM23182.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Caminibacter mediatlanticus
           TB-2]
          Length = 187

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 108/168 (64%), Gaps = 2/168 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D RG+F +T+   L ++   +  F+QDN S S   G +RGLH+Q PP+AQ
Sbjct: 11  VVIIEPKVFGDDRGYFMETFRQDLFEKNIRKIDFIQDNESKS-KRGVLRGLHYQLPPFAQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVR I G++ D+AVDIR+NSPT+  +V++E+S  N  Q++IP GFAHGF+ L      
Sbjct: 70  SKLVRVIKGKVLDVAVDIRKNSPTFKQYVAVELSEENKRQLFIPRGFAHGFLVLSDEAIF 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
            YKV ++YS EHD  + + D  I I W      L  +SEKD+N PFL 
Sbjct: 130 TYKVDNYYSPEHDRSIRFDDLEIGIDWNFPKEEL-IISEKDKNAPFLK 176


>gi|29346748|ref|NP_810251.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338645|gb|AAO76445.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 182

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 108/174 (62%), Gaps = 6/174 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  V I++ R F+D RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   NIEGVVIIEPRIFKDDRGYFFESFSQREFEEKVCKTTFVQDNESKS-SYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR I G + D+AVDIR+ SPT+G +VS+E++  N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVIKGAVLDVAVDIRKGSPTFGQYVSVELTGENHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
                YK  +FYS + +  +AW D  ++I W  P    +L   SEKD   P L 
Sbjct: 126 EVIFQYKCDNFYSPQSEGAIAWNDPDLNIDWRIPAEKVVL---SEKDSKHPRLK 176


>gi|326385995|ref|ZP_08207619.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209220|gb|EGD60013.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 149

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)

Query: 39  FVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEI 98
           FVQ+N S S   GTIRGLHFQ  P+AQ KLVRC+ G IFD+AVD+R  SPTYG W    +
Sbjct: 6   FVQENQSLSMAQGTIRGLHFQSEPFAQGKLVRCVEGAIFDVAVDLRHGSPTYGQWAGATL 65

Query: 99  SANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTI 158
           +A +  Q++IP+GFAHGF TL   T V YKVT +YS E+D G+AW D  +++ WP  D  
Sbjct: 66  TAQDCNQLWIPSGFAHGFCTLVPQTVVAYKVTAYYSRENDLGLAWDDPDVNVAWP--DVA 123

Query: 159 LPS-VSEKDQNLPFLNQIDSPFE 180
            P+ +S KDQ  P L  + S FE
Sbjct: 124 DPTKLSAKDQVQPRLADLPSYFE 146


>gi|209883703|ref|YP_002287560.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oligotropha carboxidovorans
           OM5]
 gi|209871899|gb|ACI91695.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oligotropha carboxidovorans
           OM5]
          Length = 181

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 109/172 (63%), Gaps = 4/172 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQR 60
            ++ V +++ + F D+RG+F ++++++  +E   +DV FVQDN S S   G +RGLH+Q 
Sbjct: 7   TLDGVVVIEPQVFTDARGYFFESFNAERFRERVARDVTFVQDNQSLS-RKGVVRGLHYQI 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KLVR +AG IFD+AVDIR+ S  +G W    +SA N  Q+++P G+AHGF  L 
Sbjct: 66  APKAQGKLVRALAGEIFDVAVDIRKGSKQFGQWFGTILSAENKKQLWVPEGYAHGFQVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
              EV+YK TDF+S  H+  + W D ++ I WPL +  +  VS KD   P L
Sbjct: 126 ETAEVLYKTTDFWSAAHERAIRWDDPTLAIDWPLKEGCI--VSGKDGEAPLL 175


>gi|256830322|ref|YP_003159050.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579498|gb|ACU90634.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 185

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 108/173 (62%), Gaps = 9/173 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLL-KELGLQDVFVQDNHSFSFDCGTIR 54
           MN  P+ I     L  R F D RG+F ++++++   K  G+  VFVQDNHS S   G +R
Sbjct: 1   MNAKPLSIPEVILLTPRVFGDDRGFFYESFNAQAFTKATGVATVFVQDNHSCS-QRGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q PPYAQ KLVR + G +FD+AVDIRR S T+G WV   +SA N  Q++IP GFAH
Sbjct: 60  GLHYQLPPYAQGKLVRVVHGEVFDVAVDIRRYSSTFGKWVGTLLSAENKRQLWIPPGFAH 119

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           GF+TL    E +YK T +Y+   +  + W D  I I WP  +   P +S+KD+
Sbjct: 120 GFITLSDRAEFLYKTTAYYAPVAERCIRWNDLDIGIDWPYSEA--PFLSKKDK 170


>gi|194466300|ref|ZP_03072287.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri 100-23]
 gi|194453336|gb|EDX42233.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri 100-23]
          Length = 193

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 108/182 (59%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I+    F D RG+F +TYS +  K  G+   FVQDN S S   G +RGLHFQR  
Sbjct: 11  LQDVKIITPAVFGDHRGFFEETYSDRDFKAAGIDFDFVQDNQSLSTQAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R+ SPTY  W    +SA+N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDLRKGSPTYKQWEGYILSASNHRQLLVPRGFAHGFLTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSPF 179
              +YK  ++Y  E D G++++   ++I WP+  D  +   SEKD   P L +   D+PF
Sbjct: 131 VNFVYKCDNYYDAEADGGISFKTPELNIDWPIEFDKAI--TSEKDAAQPTLTEFEKDNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|91202740|emb|CAJ72379.1| strongly sinmilar to dTDP-4-deoxyrhamnose 3,5 epimerase [Candidatus
           Kuenenia stuttgartiensis]
          Length = 187

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 108/170 (63%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V ++K + F D RG+F +T+      E+G+   FVQDNHS+S    T+RGLH+Q   + Q
Sbjct: 13  VVLIKPQVFRDDRGFFLETFHKNKYAEVGISGNFVQDNHSYS-KKNTLRGLHYQLL-HPQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV  I+G IFD+AVDIRR SP++G W  + +SA N  Q+YIP GFAHGF+ L    +V
Sbjct: 71  GKLVYVISGEIFDVAVDIRRGSPSFGKWTGVHLSAENKYQLYIPEGFAHGFLVLSETADV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           +YK T+ Y+ + D G+ W D +I+ITW    +  P +S+KDQ    L  I
Sbjct: 131 LYKCTEIYTPDDDYGILWSDPAINITW---QSSSPILSKKDQEYQTLKNI 177


>gi|188588633|ref|YP_001922562.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188498914|gb|ACD52050.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 192

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 108/175 (61%), Gaps = 2/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I+ V I++ + F D+RG+F +TY+ +   E GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  SIDGVYIIEPKVFGDNRGYFMETYNREQFLEAGLDMTFVQDNESRS-TKGVLRGLHFQKK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            ++Q KLVR   G +FD+AVD+R  SPTYG + ++ ++  N  Q YIP GFAHGF+ L  
Sbjct: 69  -HSQGKLVRATKGEVFDVAVDLRHGSPTYGKYEAVILTEENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
                YK TD Y+ E+D GV W D  I+I WPL       +SEKD+  P L  +D
Sbjct: 128 EAVFNYKCTDLYAPEYDGGVMWNDNDINIKWPLDKIEDIVLSEKDKVHPNLKDLD 182


>gi|213967238|ref|ZP_03395387.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato T1]
 gi|301381026|ref|ZP_07229444.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302059365|ref|ZP_07250906.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato K40]
 gi|302134882|ref|ZP_07260872.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213928080|gb|EEB61626.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato T1]
          Length = 181

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 112/170 (65%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKTFGDDRGFFFESFNQKAFEEVVGRPVKFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFIV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D ++ I WP  +T  PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDATVGIEWPFSET--PSLSAKDQK 170


>gi|110640208|ref|YP_680418.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cytophaga hutchinsonii ATCC
           33406]
 gi|110282889|gb|ABG61075.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cytophaga hutchinsonii ATCC
           33406]
          Length = 181

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 110/181 (60%), Gaps = 5/181 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + +  V ++    F D RG+F +TY+  +  + GL   FVQDNHS S   G +RGLHFQ+
Sbjct: 6   LELKDVILISPNVFGDERGFFMETYNKAVFSKAGLDREFVQDNHSKS-SAGVLRGLHFQK 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PYAQ KLVR   G I+DI VD+R+NS TY   + + +   +   +Y+P GFAHGF+++E
Sbjct: 65  NPYAQGKLVRATKGSIWDIVVDLRKNSATYKKAIKILLDDKDKRMLYVPEGFAHGFISIE 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            + EV YK T+ Y+ E + G+ W D  + I W + +   P VS KDQ LP+L  I+S   
Sbjct: 125 -DCEVQYKCTNLYNKESEGGIRWNDPELGIDWGIEN---PVVSTKDQELPYLKDIESALN 180

Query: 181 Y 181
           +
Sbjct: 181 F 181


>gi|150006431|ref|YP_001301175.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus ATCC
           8482]
 gi|237712178|ref|ZP_04542659.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 9_1_42FAA]
 gi|237726325|ref|ZP_04556806.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D4]
 gi|254881652|ref|ZP_05254362.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 4_3_47FAA]
 gi|265751869|ref|ZP_06087662.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_33FAA]
 gi|294777048|ref|ZP_06742506.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus PC510]
 gi|319643037|ref|ZP_07997670.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_40A]
 gi|149934855|gb|ABR41553.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus ATCC
           8482]
 gi|229434851|gb|EEO44928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides dorei 5_1_36/D4]
 gi|229453499|gb|EEO59220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 9_1_42FAA]
 gi|254834445|gb|EET14754.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 4_3_47FAA]
 gi|263236661|gb|EEZ22131.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_33FAA]
 gi|294449106|gb|EFG17648.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides vulgatus PC510]
 gi|317385318|gb|EFV66264.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_40A]
          Length = 189

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 114/181 (62%), Gaps = 4/181 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V IL+ R F D+RG+F +++S +  +E   +  FVQDN SFS   G +RGLHFQ+PP
Sbjct: 8   IDGVFILEPRIFNDARGYFFESFSGREFEEKVCRTTFVQDNESFS-TYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q+KLVR I G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF  L   
Sbjct: 67  FTQSKLVRVIKGAVLDVAVDIRKGSPTFGKHVAVELTGENHRQFFIPRGFAHGFAVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK   +Y+ + + G+AW D  + I W L  D ++  +S+KD+  P L    + F++
Sbjct: 127 VLFQYKCDHYYAPQSEGGIAWDDPDLGIDWRLPADKVI--LSDKDKKHPRLKDYQTDFDF 184

Query: 182 D 182
           +
Sbjct: 185 N 185


>gi|124004205|ref|ZP_01689051.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Microscilla marina ATCC
           23134]
 gi|123990275|gb|EAY29774.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Microscilla marina ATCC
           23134]
          Length = 183

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 114/173 (65%), Gaps = 3/173 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           + + R FED RG+F ++++ ++  K  G+   F+QDNHSFS   G +RGLHFQ+PP+AQA
Sbjct: 13  LFEPRIFEDDRGYFYESFNQNEFTKATGITSPFIQDNHSFS-KKGVLRGLHFQKPPHAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KL++ I G I+D+ VD+R++SPT+   +  E+SA N  Q+Y+P GFAHGF+ L  + EV+
Sbjct: 72  KLIKVIQGTIWDVVVDLRKDSPTFSQHLGFELSAGNKKQLYVPQGFAHGFIVLSDSAEVL 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           YK  +FY+ + +SG+ + D  + I W  +D+    +SEKD  L      + PF
Sbjct: 132 YKCDNFYAPQAESGIIYNDSDLAIDWK-IDSSNIIISEKDAVLATFQPSNIPF 183


>gi|224535807|ref|ZP_03676346.1| hypothetical protein BACCELL_00671 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522530|gb|EEF91635.1| hypothetical protein BACCELL_00671 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 190

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 111/182 (60%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V I++ R F D RG+F +++S     E  +   FVQDN S S   G +RGLHFQ+ P
Sbjct: 8   IDGVVIIEPRIFCDERGYFFESFSQLEFDEKVMPINFVQDNESMS-SYGVMRGLHFQKMP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q+KLVRC+ G + D+AVDIR+ SPTYG  V++E+S +N  Q +IP GFAHGF  L   
Sbjct: 67  YTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELSEDNHRQFFIPRGFAHGFSVLTEI 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + D G+   D S+ I W  P    IL   SEKD   P L + DSPF+
Sbjct: 127 AVFQYKCDNFYAPQADGGIQLIDGSLGIDWRIPTNKVIL---SEKDLKHPLLAEYDSPFD 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|156340233|ref|XP_001620391.1| hypothetical protein NEMVEDRAFT_v1g231483 [Nematostella vectensis]
 gi|156205251|gb|EDO28291.1| predicted protein [Nematostella vectensis]
          Length = 181

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 109/164 (66%), Gaps = 5/164 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++   E  GLQ  FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VIILEPKVFGDQRGFFFESFNARSFAEATGLQREFVQDNHSRS-QRGVLRGLHYQ-VQQA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG ++D+AVD+RR+SPT+G WV + +SA N  Q+++P GFAHGF+ L    E
Sbjct: 69  QGKLVRVTAGEVYDVAVDLRRSSPTFGRWVGVHLSAENNRQLWVPEGFAHGFVVLSEFAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK TD+Y+ EH+  + W D ++ I WPL     P +S KDQ+
Sbjct: 129 FLYKTTDYYAPEHERCIRWDDPTLAIDWPLDGA--PQLSAKDQS 170


>gi|91776362|ref|YP_546118.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacillus flagellatus
           KT]
 gi|91710349|gb|ABE50277.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacillus flagellatus
           KT]
          Length = 182

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 115/182 (63%), Gaps = 9/182 (4%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P  I      + + F D+RG+F ++++ K  +E +G +  FVQDNHS S   G +R
Sbjct: 1   MNVTPTHIPDVIVFEPKIFGDARGFFFESFNQKAFEEAVGRKYDFVQDNHSKS-SKGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q    AQ KLVR +AG +FD+AVDIR++SPT+G WV   +SA N  Q+++P GFAH
Sbjct: 60  GLHYQIQ-QAQGKLVRVVAGEVFDVAVDIRKSSPTFGQWVGQHLSAENKKQMWVPPGFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           GF+ L    E +YK TDFY+  H+  ++W D  + I WP + T  P +S KDQ    L+Q
Sbjct: 119 GFLVLSETAEFLYKTTDFYAPAHERCLSWNDPVVGIEWPDIGTP-PLLSSKDQQGLGLHQ 177

Query: 175 ID 176
            +
Sbjct: 178 TE 179


>gi|158333602|ref|YP_001514774.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acaryochloris marina
           MBIC11017]
 gi|158303843|gb|ABW25460.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acaryochloris marina
           MBIC11017]
          Length = 187

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 113/186 (60%), Gaps = 12/186 (6%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPYA 64
           V +++ R F D RG+F +TY  +     G+ ++FVQDNHS S   GT+RGLHFQ + P  
Sbjct: 11  VLVIEPRVFSDQRGFFLETYHRQRYTASGIDEIFVQDNHSRSAH-GTLRGLHFQLKSP-- 67

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG +FD+AVDIRR SP +G W    +S  N  Q+Y+P GFAHGF  L    +
Sbjct: 68  QGKLVRVSAGEVFDVAVDIRRGSPYFGQWFGEYLSGENNKQMYVPPGFAHGFCVLSETAD 127

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
            +YK +DFY    + GVAW D ++ I WP+   IL   S+KD  LP ++++      D L
Sbjct: 128 FMYKCSDFYDPTDEQGVAWDDPALAIDWPIDQPIL---SKKDAALPKMSEL-----MDCL 179

Query: 185 PLLSLN 190
           P  +++
Sbjct: 180 PRFAMS 185


>gi|194466818|ref|ZP_03072805.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri 100-23]
 gi|194453854|gb|EDX42751.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri 100-23]
          Length = 193

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I+    F D RG+F +TYS +  K  G+   F+QDN S S   G +RGLHFQR  
Sbjct: 11  LQDVKIITPAVFGDHRGFFEETYSDRDFKAAGIDFNFIQDNQSLSTQAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R+ SPTY  W    +SA+N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDLRKGSPTYKQWEGYILSASNHRQLLVPRGFAHGFLTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSPF 179
              +YK  ++Y  E D G++++   ++I WP+  D  +   SEKD   P L +   D+PF
Sbjct: 131 VNFVYKCDNYYDAEADGGISFKTPELNIDWPIEFDKAI--TSEKDAAQPTLTEFEKDNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|124025562|ref|YP_001014678.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           NATL1A]
 gi|123960630|gb|ABM75413.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           NATL1A]
          Length = 193

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 107/163 (65%), Gaps = 3/163 (1%)

Query: 14  FEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           F D RG+F ++++ K+    LG +  F QDN S S   G +RGLH+Q  P +Q KLVRC 
Sbjct: 24  FNDERGYFYESWNEKIFNSILGKEVRFKQDNISHSIK-GVLRGLHYQLKPESQGKLVRCS 82

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            G IFD+AVDIR+ S T+G W+S E+S+ N  Q++IP GFAHGF+T+  + EV YK T F
Sbjct: 83  YGSIFDVAVDIRKESKTFGKWLSAELSSENKKQLWIPVGFAHGFLTISDHAEVNYKATGF 142

Query: 133 YSVEHDSGVAWQDKSIDITWPLLD-TILPSVSEKDQNLPFLNQ 174
           ++ + +  + W DK + ITWP+ +    P ++EKD + PFL +
Sbjct: 143 WNKDCEHSIRWNDKDLKITWPIKEFGFEPVINEKDASAPFLKE 185


>gi|298481049|ref|ZP_06999243.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
 gi|298272623|gb|EFI14190.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
          Length = 193

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 114/185 (61%), Gaps = 10/185 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ V +++ + F+D+RG+F +++S +  ++   +  FVQDN S S   G +RG HFQ P
Sbjct: 7   KIDGVVVIEPKVFKDTRGYFLESFSLREFEKKVRKISFVQDNESMS-SYGVMRGFHFQFP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q+KLVRC+ GR+ D+AVDIR+ S TYG  V++E+S  N  Q ++P GFAHGF  L  
Sbjct: 66  PYTQSKLVRCVKGRVLDVAVDIRKGSSTYGQHVAVELSEENHHQFFVPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQNLPFLNQIDS 177
                YK  +FY+ + D G++ +D+ + I W     ++PS    +SEKD    FL   DS
Sbjct: 126 IAVFQYKCDNFYNPQADGGISIKDEGLGINW-----MIPSESIILSEKDTRHTFLKNFDS 180

Query: 178 PFEYD 182
           PF  D
Sbjct: 181 PFSID 185


>gi|116491430|ref|YP_810974.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oenococcus oeni PSU-1]
 gi|290891010|ref|ZP_06554074.1| hypothetical protein AWRIB429_1464 [Oenococcus oeni AWRIB429]
 gi|116092155|gb|ABJ57309.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oenococcus oeni PSU-1]
 gi|290479409|gb|EFD88069.1| hypothetical protein AWRIB429_1464 [Oenococcus oeni AWRIB429]
          Length = 189

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 112/180 (62%), Gaps = 1/180 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           ++  V++++T  F D RG+F++T++ +  ++LGL+  F QDN S S + G +RG+H+Q  
Sbjct: 8   SLQDVKLIETEVFGDKRGFFTETWTKEKFEKLGLKFDFTQDNQSLSAEAGVLRGMHYQLA 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ K+VR + G ++D  VD+R+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  
Sbjct: 68  PYAQTKIVRVVTGVVWDCLVDMRKGSPTYGKWEGYILSEYNHRQLLVPKGFAHGFVTLTP 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           N   +YKV  +Y+ + D G+A+ D  + I WP  +     +S+KD   P L   ++ F Y
Sbjct: 128 NVNFVYKVDGYYAPKADRGIAFDDPDVGIQWP-TNVEHAIMSDKDLKHPLLKDAENNFVY 186


>gi|159896798|ref|YP_001543045.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159889837|gb|ABX02917.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 188

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 111/183 (60%), Gaps = 6/183 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V I+K   F D RG+F +TY      +LGL   FVQDNHS S   G +RGLH+Q   
Sbjct: 10  LDGVVIIKPSVFADERGFFLETYHQIKFADLGLPTDFVQDNHSRS-KQGVLRGLHYQDER 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
              AKLVRC  G IFD+AVD+R  SPT+G WV +E+SA+N LQ  IP+GF HGF+ L   
Sbjct: 69  QPMAKLVRCSVGSIFDVAVDLRVGSPTFGKWVGVELSADNFLQFLIPSGFGHGFVVLSEF 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPFLNQIDSP-FE 180
            EV Y+ T  Y+ E +  V W D  I I WP+ +   P++S +DQ  +   + +++P F 
Sbjct: 129 AEVQYRCTGLYAPETEGAVRWNDPQIGIEWPISE---PTLSGRDQAAMSLADYLENPAFR 185

Query: 181 YDG 183
           Y G
Sbjct: 186 YRG 188


>gi|317048788|ref|YP_004116436.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pantoea sp. At-9b]
 gi|316950405|gb|ADU69880.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pantoea sp. At-9b]
          Length = 182

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 105/161 (65%), Gaps = 2/161 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+I++   F D RG+F +T+  K  +EL     FVQDNHS S   G +RGLH+Q     Q
Sbjct: 11  VKIIEPAVFGDERGFFMETWQQKKFEELVSPRTFVQDNHSKS-SKGILRGLHYQTV-NTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR +AG +FD+AVD+RR+SPT+G WV + +SA N  Q+++P GFAHGF     + E 
Sbjct: 69  GKLVRVVAGEVFDVAVDMRRSSPTFGKWVGVLLSAENKRQLWVPEGFAHGFYVTSDSAEF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y+ +H+  + W D+ ++I WP+     PS+S KD
Sbjct: 129 VYKCTDYYNPQHEHSLLWNDRELNINWPINSDNPPSLSAKD 169


>gi|262066767|ref|ZP_06026379.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379570|gb|EFE87088.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium periodonticum
           ATCC 33693]
          Length = 187

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + IL+ R FEDSRG+F ++Y+    KE+G+ ++FVQDN S S     +RGLHFQ+  
Sbjct: 8   IKDLLILEPRVFEDSRGFFMESYNYNTFKEIGIDNIFVQDNISKS-SKAVLRGLHFQKDE 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQAKLV  + G + D+ VD+R NS T+G + ++E++  N   ++IP GFAH F+TLE +
Sbjct: 67  YAQAKLVYVLRGAVLDVTVDLRENSETFGKYEAVELNEKNKRMLFIPRGFAHAFLTLEND 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
           TE IYK  +FY+ + + G+ W D  ++I W L    +      +SEKD +N+ F
Sbjct: 127 TEFIYKCDNFYNPKSEVGIVWNDVDLNINWNLEKYNIKEEELIISEKDKKNITF 180


>gi|227543972|ref|ZP_03974021.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri
           CF48-3A]
 gi|300909571|ref|ZP_07127032.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri SD2112]
 gi|227186033|gb|EEI66104.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri
           CF48-3A]
 gi|300893436|gb|EFK86795.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus reuteri SD2112]
          Length = 193

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+I+    F D RG+F +TYS +  K  G+   F+QDN S S   G +RGLHFQR  
Sbjct: 11  LQDVKIITPAVFGDHRGFFEETYSDRDFKAAGIDFNFIQDNQSLSTHAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R + G + D+ VD+R+ SPTY  W    +SA+N  Q+ +P GFAHGF+TL  N
Sbjct: 71  AAQTKLIRVVTGAVLDVIVDLRKGSPTYKQWEGYILSASNHRQLLVPRGFAHGFLTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQI--DSPF 179
              +YK  ++Y  E D G++++   ++I WP+  D  +   SEKD   P L +   D+PF
Sbjct: 131 VNFVYKCDNYYDAEADGGISFKTPELNIDWPIEFDKAI--TSEKDAAQPTLTEFEKDNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|218248087|ref|YP_002373458.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 8801]
 gi|218168565|gb|ACK67302.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 8801]
          Length = 176

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 106/167 (63%), Gaps = 3/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +N   +++ ++ ED RG+F++++  K   + GL    VQ N SF+   GT+RG+H+Q  
Sbjct: 7   KLNGAYLIELKRLEDERGFFARSWCQKEFLDYGLDANLVQCNISFNLKKGTLRGMHYQIA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY + KL+RC  G I+D+ +D+   S ++  W+ +E+SA N L IYIP GFAHGF TLE 
Sbjct: 67  PYEEVKLLRCTQGAIYDVIIDLNLESSSFKQWIGVELSAENRLMIYIPKGFAHGFQTLED 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           +TEV Y++++FY  E   GV W D +  I WP+ D   P +SEKD+ 
Sbjct: 127 HTEVFYQMSEFYHPECARGVRWNDPTFAIEWPIED---PIISEKDRQ 170


>gi|298353050|gb|ADI77028.1| RmlC [Escherichia coli]
          Length = 182

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++    F DSRG+F ++++ +  + +   + VF QDN S S   G +RGLHFQ  P  QA
Sbjct: 13  VITPEVFADSRGYFFESFNYRDFQRIINREIVFCQDNQSLSHK-GVVRGLHFQVNPKEQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVRCI G ++D+ VD+R+NSP+Y CW  + +S++N  Q++IP G AHGF++LE NTE++
Sbjct: 72  KLVRCINGSVYDVIVDLRKNSPSYKCWFGILLSSDNKKQLWIPEGCAHGFISLEDNTELL 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           YK T+FYS +H+  + W D  + I+WP    I   +S+KD+N
Sbjct: 132 YKTTEFYSPDHERCIIWNDPDLGISWPEYSYI---ISDKDKN 170


>gi|323483216|ref|ZP_08088607.1| hypothetical protein HMPREF9474_00356 [Clostridium symbiosum
           WAL-14163]
 gi|323691340|ref|ZP_08105615.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium symbiosum
           WAL-14673]
 gi|323403489|gb|EGA95796.1| hypothetical protein HMPREF9474_00356 [Clostridium symbiosum
           WAL-14163]
 gi|323504680|gb|EGB20467.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium symbiosum
           WAL-14673]
          Length = 186

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 103/167 (61%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+    +E GL  VFVQDN S S   G +RGLH+Q+ 
Sbjct: 10  DIEGLYVIEPTVFKDERGYFVETYNQNDFREAGLDMVFVQDNQSMSVK-GVLRGLHYQKE 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R  S TYG W  + ISA N  Q YIP GFAHGF+ L  
Sbjct: 69  -FPQGKLVRAVRGEVFDVAVDLRTGSRTYGKWFGVVISAENKKQFYIPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+A+ D  I I WP+ + +   +SEKD+ 
Sbjct: 128 EAEFAYKCTDFYHPGDEGGLAYNDPEIGIEWPVTEGMELIISEKDKK 174


>gi|237739562|ref|ZP_04570043.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 2_1_31]
 gi|229423170|gb|EEO38217.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 2_1_31]
          Length = 187

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 114/174 (65%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + FEDSRG+F ++Y+    KELG+ +VFVQDN S S   G +RGLHFQR  
Sbjct: 8   IKNLLLIEPKIFEDSRGFFMESYNYNTFKELGIDNVFVQDNISKS-SKGVLRGLHFQRDE 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQAKLV  + G + DI VD+R++S T+G + ++E++  N   ++IP GFAHGF+TLE N
Sbjct: 67  YAQAKLVYVLRGAVLDITVDLRKDSETFGRYEAVELNDKNKRMLFIPRGFAHGFLTLEDN 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
           TE +YK  +FY+ + + G+ W D  ++  W L    +      +SEKD +N+ F
Sbjct: 127 TEFVYKCDNFYNPKSEVGIIWNDTDLNTDWNLDKYNIKEEELIISEKDKKNITF 180


>gi|312891211|ref|ZP_07750732.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mucilaginibacter paludis DSM
           18603]
 gi|311296290|gb|EFQ73438.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Mucilaginibacter paludis DSM
           18603]
          Length = 182

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (60%), Gaps = 6/179 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ R F D RG+F ++Y+ +   E G+   FVQDN S S   GT+RGLH Q PP
Sbjct: 8   IEGLLIIEPRVFPDDRGYFYESYNQQKYIEAGINVNFVQDNQSSS-SKGTLRGLHAQAPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR I G + D+AVDIR+ SPTYG ++ +++SA N LQ++IP GF HGF  LE +
Sbjct: 67  YGQDKLVRVIKGSVIDVAVDIRKGSPTYGQYLKIKLSAQNNLQLWIPQGFLHGFFALEDD 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +   YK+T+FY    + GV   D  + I W  P+ D  L   S KD+ LP      SPF
Sbjct: 127 SIFAYKITNFYDKASEIGVKITDPELGIDWGFPISDITL---SPKDEALPDFKSFVSPF 182


>gi|93115472|gb|ABE98432.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
          Length = 177

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 3/165 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + +KFEDSRG+F ++++ +L ++ +G + +FVQDN S+S     +RGLH+Q  
Sbjct: 8   IPEVLIFEPKKFEDSRGYFFESFNQRLFEDAVGKETLFVQDNQSYS-SKNVLRGLHYQSE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRCI G +FD+AVDIR+ S +YG WV + +S +N  Q++IP GFAHGF+    
Sbjct: 67  PYAQGKLVRCIMGEVFDVAVDIRKESESYGQWVGVFLSEDNNRQLWIPEGFAHGFLVKSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
                YK T+FY+   ++ + W    + I WPL D  L  +SEKD
Sbjct: 127 KAIFAYKCTNFYNPSAENTIRWDSPDLAIEWPLDDEDL-LISEKD 170


>gi|108805902|ref|YP_645839.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rubrobacter xylanophilus DSM
           9941]
 gi|108767145|gb|ABG06027.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rubrobacter xylanophilus DSM
           9941]
          Length = 183

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 106/170 (62%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++ + F D RG+F ++++ +  +E GL + FVQDN S S   G +RGLHFQ P   Q
Sbjct: 11  VLVVEPQVFGDERGFFMESFNGRRYREAGLPERFVQDNLSLS-RRGVLRGLHFQHP-RGQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV  + G +FD+AVD+RR SPT+G WV L +S  N  Q+YIP GFAHGF+ L      
Sbjct: 69  GKLVSVLRGEVFDVAVDVRRGSPTFGRWVGLSLSEENRRQLYIPPGFAHGFVVLSEAALF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            YK T++Y+ E +  V W D  I I WP+ + +L   SEKD+  P L ++
Sbjct: 129 FYKCTEYYAPECERTVLWSDPEIGIGWPVEEPVL---SEKDRKAPALREM 175


>gi|254711650|ref|ZP_05173461.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella pinnipedialis B2/94]
 gi|256029716|ref|ZP_05443330.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella pinnipedialis
           M292/94/1]
 gi|261319274|ref|ZP_05958471.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis B2/94]
 gi|265986727|ref|ZP_06099284.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis M292/94/1]
 gi|261298497|gb|EEY01994.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis B2/94]
 gi|264658924|gb|EEZ29185.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis M292/94/1]
          Length = 174

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 109/172 (63%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NIN    L+  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNINGAWSLEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+++ KLV C+ G ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL 
Sbjct: 66  EPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 174


>gi|298527744|ref|ZP_07015148.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511396|gb|EFI35298.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 183

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 109/171 (63%), Gaps = 3/171 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +N   +++  +  D RG+FS+T+  +  +++GL     Q N +F+   GT+RG+HFQ  P
Sbjct: 8   LNGAYLIRLERHNDDRGFFSRTFCRREFEKMGLNSEISQCNLAFNNKAGTLRGMHFQTQP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y++ KLV C++G +FD+ +D+R  S TY CW   ++SA+N   +Y+P GFAHG+ TL  N
Sbjct: 68  YSEVKLVGCVSGSVFDVIIDLREESTTYSCWFGTKLSADNLEMLYVPKGFAHGYQTLVDN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
             V Y V++ Y  E+++GV W D  ++I+WPL    + +VS+KD   P LN
Sbjct: 128 AAVSYMVSESYCPEYENGVRWNDPVLNISWPLE---VITVSKKDSAWPLLN 175


>gi|298485660|ref|ZP_07003739.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159686|gb|EFI00728.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 181

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 112/170 (65%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKVFGDDRGFFFESFNQKAFEEVVGRPVTFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR  AG +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTAGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D ++ I WP  +   PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDVTVGIDWPFSEA--PSLSAKDQK 170


>gi|327404038|ref|YP_004344876.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fluviicola taffensis DSM
           16823]
 gi|327319546|gb|AEA44038.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fluviicola taffensis DSM
           16823]
          Length = 182

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 112/176 (63%), Gaps = 5/176 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V +++   F D RG+F +++  +   E +G +  FVQDN S S   G +RGLHFQ PP+A
Sbjct: 11  VLLIQPTIFGDDRGYFFESFHQQKFNEFIGAEINFVQDNESKSAK-GVLRGLHFQAPPHA 69

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G + D+A+DIR+NSPTYG  VS  +SA N +Q YIP GFAHGF+TLE +T 
Sbjct: 70  QGKLVRVVQGSVLDVALDIRKNSPTYGQHVSFVLSAENKMQAYIPAGFAHGFVTLEKDTI 129

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
             YK T++Y+   +  + W D ++ I W  ++ IL   S+KD+    L   +SPFE
Sbjct: 130 FQYKCTNWYNPSSEGSILWNDPALTIQWQEMNPIL---SDKDKLGILLADFNSPFE 182


>gi|303248974|ref|ZP_07335220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio fructosovorans
           JJ]
 gi|302489623|gb|EFL49561.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfovibrio fructosovorans
           JJ]
          Length = 193

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (61%), Gaps = 3/175 (1%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           +K + F D+RG+F +TYS       GL   FVQDNH+ S   G +RGLHFQRPP  QAKL
Sbjct: 14  IKPKVFGDNRGFFLETYSRAAFAAAGLDYDFVQDNHARSGPKGVLRGLHFQRPPSTQAKL 73

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           V  + G + D+ VD+R  SPTY  W  +E++ +N +++ +P GFAHG++TL  N E +YK
Sbjct: 74  VWVVRGAVLDVVVDLRVGSPTYKKWFGIELTEDNFMRLMVPRGFAHGYVTLTENAEFMYK 133

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDG 183
           V   Y    D+G+AW D  I I WP+ + IL   SEKD   P L  + SPF Y G
Sbjct: 134 VDAPYVPADDAGIAWNDPEIGIDWPVAEPIL---SEKDARQPTLAALGSPFIYQG 185


>gi|237743314|ref|ZP_04573795.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 7_1]
 gi|229433093|gb|EEO43305.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 7_1]
          Length = 164

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 6/154 (3%)

Query: 23  QTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVD 82
           ++Y+    KELG++++FVQDNHS S   G +RGLHFQ+  Y+QAKLVR + G + DIA+D
Sbjct: 2   ESYNYNTFKELGIENIFVQDNHSKS-SKGVLRGLHFQKGEYSQAKLVRVLKGAVLDIAID 60

Query: 83  IRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVA 142
           +R+NS T+G +V++E+S  N    +IP  FAHGF+TLE NTE  YK  +FY+ + ++G+ 
Sbjct: 61  LRKNSKTFGKYVTVELSEKNKKMFFIPRNFAHGFLTLEDNTEFFYKCDNFYNPKSEAGIM 120

Query: 143 WQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
           W DK ++I W      +      +SEKD +N+ F
Sbjct: 121 WNDKDLNIEWNFKKYGINENELIISEKDKKNMSF 154


>gi|313202900|ref|YP_004041557.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Paludibacter propionicigenes
           WB4]
 gi|312442216|gb|ADQ78572.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paludibacter propionicigenes
           WB4]
          Length = 190

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 115/182 (63%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V I++   F D RG+F +++S K  +E   + VFVQDN S S   G +RGLH+Q+P
Sbjct: 7   KLEGVCIIEPVVFADERGYFFESFSQKEFEEKVCKTVFVQDNESKS-TYGVLRGLHYQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ+KLVR + G++ D+A+DIRR SPT+G  V++E+S  N  Q ++P GFAHGF+ L  
Sbjct: 66  PYAQSKLVRVVKGKVLDVALDIRRGSPTFGQHVAVELSEENKRQFFVPRGFAHGFVVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
           +    YK  +FY+ +++  +AW D  + I W  P  D IL   SEKD++   L ++   F
Sbjct: 126 DVIFQYKCDNFYAPKNEGALAWDDADLSIDWKIPSGDVIL---SEKDKHHSSLKEMKLVF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|90962542|ref|YP_536458.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius
           UCC118]
 gi|90821736|gb|ABE00375.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus salivarius
           UCC118]
          Length = 193

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (60%), Gaps = 5/182 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V+++    F D+RG+F+++YS +  K  G+   F+QDNHS S   G +RGLHFQR  
Sbjct: 11  LQDVKLITPAVFGDNRGFFTESYSDRDFKAAGIDFDFIQDNHSLSTQAGVLRGLHFQRGK 70

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KL+R   G + D+ VD+R+ SPTY  W    +S +N  Q+ +P G+AHGF+TL  N
Sbjct: 71  AAQTKLIRVATGAVLDVIVDLRKGSPTYKQWEGYILSESNHRQLLVPKGYAHGFVTLTDN 130

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQID--SPF 179
              +YK  ++Y  E D G++++   ++I WP+ LD  +   SEKD N P L + +  +PF
Sbjct: 131 VNFLYKCDNYYDAEADGGISFKTPELNIDWPIDLDKAI--TSEKDANQPTLTEFEKGNPF 188

Query: 180 EY 181
            Y
Sbjct: 189 VY 190


>gi|258517208|ref|YP_003193430.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257780913|gb|ACV64807.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 182

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 102/169 (60%), Gaps = 6/169 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++   F D RG+F +TY  K   E GL   FVQDN S S   G +RGLHFQR 
Sbjct: 10  GIQGLYIIEPMIFGDHRGYFMETYHLKEFSEAGLNMAFVQDNQSKS-KKGVLRGLHFQRK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I G +FD+AVD+R +S TYG W  + +S  N  Q YIP  FAHGF+ L  
Sbjct: 69  -YPQGKLVRVIKGEVFDVAVDLRMDSKTYGKWFGVILSEENKKQFYIPESFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQN 168
             E +YK TD+Y  E + G+ W D +I I WPL  +D I+  +SEKDQ 
Sbjct: 128 EAEFVYKCTDYYHPEDEDGILWNDPAIGIAWPLDRIDDII--LSEKDQK 174


>gi|33865182|ref|NP_896741.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 8102]
 gi|33638866|emb|CAE07163.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 8102]
          Length = 195

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 106/173 (61%), Gaps = 4/173 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  + F D RGWF ++++ +   E +G   VF QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LISPQAFGDERGWFFESWNQRRFDEAVGEAVVFSQDNHSRSVQ-GVLRGLHYQLEPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G+IFD+AVDIR+ S T+G WV  ++SA N  Q+++P GFAHGF+TL    EV 
Sbjct: 78  KLVRASVGKIFDVAVDIRQGSATFGQWVGAQLSAENKQQLWVPEGFAHGFLTLSAVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWP--LLDTILPSVSEKDQNLPFLNQIDS 177
           YK   F++   +  + W D SI+I WP  LL     S+S KD   P L+Q  +
Sbjct: 138 YKARGFWNKSCERAIRWDDASINIRWPLDLLGGAEVSLSGKDAEAPTLDQAKA 190


>gi|253581530|ref|ZP_04858755.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium varium ATCC
           27725]
 gi|251836600|gb|EES65135.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium varium ATCC
           27725]
          Length = 203

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 109/169 (64%), Gaps = 6/169 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + IL+   F D RG+F +TY+ K  +E+G+ + FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IEGLYILEPTVFGDERGFFLETYNKKEFEEIGIFEEFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           ++Q KLVR I G ++D+AVDIR+ SPTYG W  +E++A N    +IP GFAHGF+TLE  
Sbjct: 69  HSQGKLVRVIKGAVYDVAVDIRKGSPTYGKWYGIELNAVNKKMFFIPKGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQ 167
           TE  YK TD Y  E+DSG+ W DK I+I W      L      +SEKD+
Sbjct: 129 TEFQYKCTDLYHPEYDSGIMWNDKDININWNFEKYGLKEENMVLSEKDK 177


>gi|310780093|ref|YP_003968425.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ilyobacter polytropus DSM
           2926]
 gi|309749416|gb|ADO84077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ilyobacter polytropus DSM
           2926]
          Length = 190

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 102/159 (64%), Gaps = 6/159 (3%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F +TY+ +  ++LG    FVQDNHS S   G +RGLHFQ+  ++Q KL+R   G 
Sbjct: 24  DQRGFFMETYNKRYFEKLGFNLEFVQDNHSKS-KKGVLRGLHFQKE-HSQGKLIRVTRGS 81

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           I+D+AVD+R+ SPT+G W  L +S  N    YIP GFAHGF+TL+ +TE+ YK TDFY  
Sbjct: 82  IWDVAVDLRKKSPTFGVWHGLILSQENKKLFYIPEGFAHGFLTLDDDTEIQYKCTDFYYP 141

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQNLP 170
           E DSG+ W D  I I WP  +  L      +SE+D + P
Sbjct: 142 EFDSGINWDDPDIGIKWPFKEFGLEEENLILSERDMDQP 180


>gi|310644323|ref|YP_003949082.1| dtdp-4-dehydrorhamnose 3,5-epimerase like protein [Paenibacillus
           polymyxa SC2]
 gi|309249274|gb|ADO58841.1| dTDP-4-dehydrorhamnose 3,5-epimerase like protein [Paenibacillus
           polymyxa SC2]
          Length = 177

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 98/153 (64%), Gaps = 2/153 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG F++ +     K  GL+  FVQ N S++   GT+RGLH+Q PPY + K+VRC  G 
Sbjct: 21  DVRGHFARAWCQDEFKSHGLECSFVQCNISYNEKKGTLRGLHYQAPPYEEVKIVRCTKGS 80

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           I+D+ VD+R +SPTY  W+S+E+S  N   +YIP GFAHG+ TL  NTEV Y+V+  Y  
Sbjct: 81  IYDVIVDLRPDSPTYKQWLSIELSDKNYKMLYIPKGFAHGYQTLSDNTEVFYQVSQMYKA 140

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           E+  GV W D   +I WP  +  +  +SEKDQN
Sbjct: 141 EYARGVKWDDPEFNIEWPEEEKRI--MSEKDQN 171


>gi|34499468|ref|NP_903683.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Chromobacterium violaceum
           ATCC 12472]
 gi|34105320|gb|AAQ61675.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Chromobacterium violaceum
           ATCC 12472]
          Length = 180

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 111/168 (66%), Gaps = 4/168 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I+ V+I++ + F D RG+F ++++ +  ++ +G    FVQDNHS S     +RGLH+Q 
Sbjct: 7   EISAVKIIEPQIFGDERGFFFESFNQQRFEQAVGHAVDFVQDNHSRS-GKNVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ Q KLVR ++G +FD+AVDIR  S T+G WV +E+SA N  Q++IP GFAHGF+TL 
Sbjct: 66  DPHPQGKLVRVVSGAVFDVAVDIRPGSETFGQWVGVELSAANKRQLWIPAGFAHGFLTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            + E +YK TD++  E +  +AW D  + I WPL D   P++S KDQ 
Sbjct: 126 DDVEFLYKTTDYWHPELERTLAWDDPDLAIAWPLSDA--PTLSAKDQT 171


>gi|228473995|ref|ZP_04058736.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga gingivalis
           ATCC 33624]
 gi|228274509|gb|EEK13350.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga gingivalis
           ATCC 33624]
          Length = 188

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 107/175 (61%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F D RG+F +++S +   E      FVQDN S S   G +RGLHFQRPP
Sbjct: 8   IEGLVIIEPKVFSDERGYFFESFSQQKFVEEVCNTTFVQDNESKS-SYGVLRGLHFQRPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR + G ++D+AVDIRR SPT+G ++ +E++  N  Q +IP GFAHGF+ L   
Sbjct: 67  YAQSKLVRVVKGIVWDVAVDIRRGSPTFGQYIGVELTEQNKRQFFIPRGFAHGFVVLSPE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQI 175
               YK   FY+  H+  V W D +I I W  P  D IL   S+KDQ  P L ++
Sbjct: 127 AIFQYKCDSFYAPTHEGSVLWNDPTIGIDWKIPHNDIIL---SQKDQQGPLLQEV 178


>gi|212634444|ref|YP_002310969.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella piezotolerans WP3]
 gi|212555928|gb|ACJ28382.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella piezotolerans WP3]
          Length = 182

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 109/171 (63%), Gaps = 7/171 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK----LLKELGL-QDVFVQDNHSFSFDCGTIRGLH 57
           I  V +++ + F D RG+F +TY       L  E GL    FVQ+N S S     +RGLH
Sbjct: 8   IADVLLIEPKVFGDERGFFMETYRESEFKILFAEAGLIAPHFVQENMSRSAKH-VLRGLH 66

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           FQ+    Q KL+R ++G IFD+AVDIR++S T+G WV   +SANN LQ+YIP GFAHGF+
Sbjct: 67  FQKSK-PQGKLIRVVSGEIFDVAVDIRQDSATFGQWVGQVLSANNRLQMYIPPGFAHGFL 125

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           TL    ++IYK TD+Y  E +  VAW D +I I WPL  ++LP +S+KD  
Sbjct: 126 TLSEYADIIYKCTDYYVPEDEGHVAWDDANIGIDWPLSKSVLPILSDKDSG 176


>gi|220909658|ref|YP_002484969.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 7425]
 gi|219866269|gb|ACL46608.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 7425]
          Length = 181

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 117/179 (65%), Gaps = 13/179 (7%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           M I P     V IL+ + + D RGWF ++++++  +E  GL   FVQDNHS+S     +R
Sbjct: 1   MKITPTEIPEVLILEPQVYGDQRGWFYESFNTRTFQEKTGLAVDFVQDNHSYS-QHHVLR 59

Query: 55  GLHFQ-RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFA 113
           GLH+Q + P  Q KLVR +AG +FD+AVD+R++S T+G WV +E+S  N  Q++IP+GFA
Sbjct: 60  GLHYQIQQP--QGKLVRAVAGMVFDVAVDLRKSSRTFGQWVGVELSGENHRQLWIPSGFA 117

Query: 114 HGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPF 171
           HGF+ L    EV+YK TD+Y+ ++D  + W D  + I WPL  T +  +S KDQ  LP+
Sbjct: 118 HGFLVLSETAEVLYKTTDYYAPQYDRCLLWNDPDLAIAWPLTGTAI--LSAKDQAGLPW 174


>gi|296114300|ref|ZP_06832954.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979061|gb|EFG85785.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 186

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 105/172 (61%), Gaps = 5/172 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V ++   +F D+RG+FS+TY+   + + G+   FVQDN S S   G +RGLH Q 
Sbjct: 6   LAIPDVILVTPARFGDTRGFFSETYNLHRMADAGIHAPFVQDNQSLSRHKGVVRGLHCQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+AQ KLVRC  G I+D+AVD R  SPTYG WV+ E+S +N  Q+++P GF HGF+T+ 
Sbjct: 66  APHAQGKLVRCTRGAIWDVAVDARMGSPTYGQWVAAELSEDNWSQLWLPPGFLHGFVTMS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLP 170
            NTEV YK T  Y    +  V W    + I WP+   D IL   S+KD+  P
Sbjct: 126 DNTEVQYKCTSLYDKASERAVIWNCPELKIDWPIAQEDAIL---SDKDKVAP 174


>gi|189502419|ref|YP_001958136.1| hypothetical protein Aasi_1062 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497860|gb|ACE06407.1| hypothetical protein Aasi_1062 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 186

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 104/169 (61%), Gaps = 3/169 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F + Y  + L +LG+ + FVQ+N SFS   GTIRGLH+Q  PYAQAKL+R I G 
Sbjct: 21  DQRGYFMECYHQEKLTQLGIHNQFVQENQSFS-KKGTIRGLHYQLNPYAQAKLIRVIDGA 79

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           I+DI VD+R+ S T+G W  + +SA N  Q+ IP G+AHGF  +     +IYK  +FY  
Sbjct: 80  IWDIIVDLRQGSTTFGQWEGIMLSAENNKQLLIPRGYAHGFAVMSQEATIIYKCDNFYHP 139

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGL 184
           E ++G+ W D  + I W +     P +S +DQ LP L +    F+Y  L
Sbjct: 140 EAEAGIHWLDPELAIDWKI--NAPPLLSARDQQLPCLEKAIINFDYQSL 186


>gi|254374810|ref|ZP_04990291.1| hypothetical protein FTDG_00986 [Francisella novicida GA99-3548]
 gi|151572529|gb|EDN38183.1| hypothetical protein FTDG_00986 [Francisella novicida GA99-3548]
          Length = 193

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 109/167 (65%), Gaps = 3/167 (1%)

Query: 16  DSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           D RG+F +++   +L   LG +  F QDN S S   G IRGLH+Q PPYAQ KLVR I G
Sbjct: 21  DERGYFIESFREDRLFDFLGYKINFCQDNESKS-SYGVIRGLHYQLPPYAQTKLVRVIQG 79

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
           ++ D+AVDIR+ SPT+G  V +E+SA+N  Q+ +P GFAHGF+ LE +T   YKV ++YS
Sbjct: 80  KVLDVAVDIRKGSPTFGQHVVVELSAHNKRQLLVPRGFAHGFVVLENDTIFSYKVDNYYS 139

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            E D G+A+ DK I I W L    L  +S KD+  P L++ D  FE+
Sbjct: 140 PECDRGIAFDDKDIAIDWQLPMGSL-KLSTKDKTQPKLSETDDLFEF 185


>gi|119485672|ref|ZP_01619947.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lyngbya sp. PCC 8106]
 gi|119456997|gb|EAW38124.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lyngbya sp. PCC 8106]
          Length = 182

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 112/182 (61%), Gaps = 9/182 (4%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P +I     L+ + F D RG+F ++++ K    + G+   FVQDNHS S   G +R
Sbjct: 1   MNVIPTKIPEVLILEPKVFGDERGFFFESFNQKSFADQTGVTTEFVQDNHSRSRQ-GVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q     Q KL+R +AG IFD+AVDIR++SPT+G WV   ISA N  Q ++P  FAH
Sbjct: 60  GLHYQTE-QVQGKLLRVVAGEIFDVAVDIRKSSPTFGQWVGCIISAENKRQFWVPPKFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           GF+ L    EV+YK TD+Y+ +H+  + W D  + I WP +D I P +S KDQ+   L  
Sbjct: 119 GFLVLSEVAEVLYKTTDYYAPQHERSILWNDPDLGIEWP-VDGITPVLSAKDQDGKTLKT 177

Query: 175 ID 176
            D
Sbjct: 178 AD 179


>gi|330962124|gb|EGH62384.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 181

 Score =  150 bits (380), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 109/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ R F D RG+F +++++K  +E  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPRVFGDERGFFYESFNAKAFQEATGLTRQFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W L     PS+S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWDDPDLAIDWQLDGQ--PSLSAKDQQGKRLKEAD 178


>gi|77920189|ref|YP_358004.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pelobacter carbinolicus DSM
           2380]
 gi|77546272|gb|ABA89834.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pelobacter carbinolicus DSM
           2380]
          Length = 168

 Score =  150 bits (380), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 110/170 (64%), Gaps = 5/170 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +++ + F D RG+F ++++ K  +   GL   FVQDNHS S   G +RGLH+Q     QA
Sbjct: 1   MIEPKIFGDQRGFFFESFNQKQWQNTTGLSTRFVQDNHSRS-ARGVLRGLHYQ-IEQVQA 58

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR I G +FD+AVDIRR+SPT+G WV + +SA N  Q++IP GFAHGF+ L    E +
Sbjct: 59  KLVRVIVGEVFDVAVDIRRHSPTFGKWVGVRLSAENKRQLWIPEGFAHGFLVLSEVAEFL 118

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           YK TD+Y+ EH+  + W D  + I WP  +   P++SEKD+    LN+ +
Sbjct: 119 YKTTDYYAPEHERAIIWNDPDLAIHWPTDEE--PTLSEKDKRALPLNEAE 166


>gi|170019636|ref|YP_001724590.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli ATCC 8739]
 gi|169754564|gb|ACA77263.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli ATCC 8739]
          Length = 177

 Score =  150 bits (380), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 3/165 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + +KFEDSRG+F ++++ +L ++ +G + +FVQDN S+S     +RGLH+Q  
Sbjct: 8   IPEVLIFEPKKFEDSRGYFFESFNQRLFEDAVGKEILFVQDNQSYS-SKNVLRGLHYQSE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRCI G +FD+AVDIR+ S +YG WV + +S +N  Q++IP GFAHGF+    
Sbjct: 67  PYAQGKLVRCIMGEVFDVAVDIRKESESYGQWVGVFLSEDNNRQLWIPEGFAHGFLVKSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
                YK T+FY+   ++ + W    + I WPL D  L  +SEKD
Sbjct: 127 KAIFAYKCTNFYNPSAENTIRWDSPDLAIEWPLDDEDL-LISEKD 170


>gi|320162336|ref|YP_004175561.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anaerolinea thermophila
           UNI-1]
 gi|319996190|dbj|BAJ64961.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anaerolinea thermophila
           UNI-1]
          Length = 182

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 111/175 (63%), Gaps = 2/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V IL+ + F D+RG+F +T+  +    LGL   FVQDNHS S   G +RGLH+Q   
Sbjct: 8   IPEVMILEPQVFRDARGFFMETFHEEKFAALGLPTRFVQDNHSAS-RRGVLRGLHYQIQ- 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR I+G +FD+AVD+RR+SPT+G WV   +SA N   ++IP GFAHGF+ L   
Sbjct: 66  QAQGKLVRVISGEVFDVAVDLRRSSPTFGQWVGEVLSAENHRMMWIPAGFAHGFLVLSDW 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            EV+YK TDFY+ + +  + W D ++ + W +     P +SEKDQ    L+Q ++
Sbjct: 126 AEVLYKTTDFYAPQWERTLLWNDPAVGVRWLISPGEQPLLSEKDQRGLPLSQCET 180


>gi|237737858|ref|ZP_04568339.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium mortiferum ATCC
           9817]
 gi|229419738|gb|EEO34785.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium mortiferum ATCC
           9817]
          Length = 470

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 121/189 (64%), Gaps = 4/189 (2%)

Query: 4   NPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPY 63
           + ++++K + F+D RG+F + ++ +  K+LG+ + FVQDNHS S   G +RGLHFQ   +
Sbjct: 12  DEIKLIKPKIFQDERGFFLEFFNYEEFKKLGIDERFVQDNHSKS-KRGVLRGLHFQ-TKH 69

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR I G I+DI VDIR+ S T+G W  +E+++ +   +YIP GFAHGF+TLE +T
Sbjct: 70  PQGKLVRVIKGAIYDIIVDIRKGSSTFGKWFGVELNSYDKKMLYIPKGFAHGFLTLEDDT 129

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILP--SVSEKDQNLPFLNQIDSPFEY 181
           E+ YK  DFY  +++SG+ + DK +++ W L +  +   ++SEKD+      +    ++ 
Sbjct: 130 EIEYKCNDFYYPQYESGIMYDDKDLNVDWKLEEYRITELTLSEKDKKHQSFKEYTERYQG 189

Query: 182 DGLPLLSLN 190
           D + L   N
Sbjct: 190 DYVLLTGAN 198


>gi|213023410|ref|ZP_03337857.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 165

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 100/156 (64%), Gaps = 2/156 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++Y+ +  +E +G +  FVQDNHS S     +RGLHFQR 
Sbjct: 9   IPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKS-KKNVLRGLHFQRG 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL  
Sbjct: 68  ENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDT 157
             E +YK T++YS   +  + W D++I I W     
Sbjct: 128 YAEFLYKATNYYSPSSEGSILWNDETIGIEWSFFSA 163


>gi|110833775|ref|YP_692634.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alcanivorax borkumensis SK2]
 gi|110646886|emb|CAL16362.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alcanivorax borkumensis SK2]
          Length = 183

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 106/166 (63%), Gaps = 5/166 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-RP 61
           I  V+++K + F D RG+F +T++++   E G+   FVQDNHS S    T+RGLH+Q + 
Sbjct: 8   IPEVKLIKPKVFGDERGFFMETWNARAFAEAGIDATFVQDNHSRSVK-NTLRGLHYQIKQ 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P  Q KLVRC  G +FD+AVD+R++SPT+G WV   +S  N  Q+++P GFAHGF+ +  
Sbjct: 67  P--QGKLVRCTRGEVFDVAVDLRKSSPTFGQWVGEILSEENQNQLWVPPGFAHGFLVMTE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL-DTILPSVSEKD 166
             +  YK TDFY+ EHD  + W D  I I WP   +   P VS+KD
Sbjct: 125 TADFQYKCTDFYAPEHDRCIHWADSKIGIDWPFEPEARSPLVSQKD 170


>gi|330951118|gb|EGH51378.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae Cit 7]
          Length = 181

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 111/170 (65%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E +G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKVFGDDRGFFFESFNQKAFEEAVGRSVTFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D ++ I WP  +   PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDTTVGIDWPFGEA--PSLSAKDQK 170


>gi|260428729|ref|ZP_05782707.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Citreicella sp. SE45]
 gi|260420323|gb|EEX13575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Citreicella sp. SE45]
          Length = 202

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I+   +F D+RG FS+ ++   L+   +   FVQDN S S D G +RGLH Q PP AQ
Sbjct: 24  VVIVTPNRFGDARGHFSEVWNRDTLRGHAIDIEFVQDNQSLSRDVGVVRGLHCQAPPRAQ 83

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G IFD+AVD+RR+S TYG WV +E+SA NG Q+ +P GF HGF+T E +T V
Sbjct: 84  DKLVRVAQGAIFDVAVDVRRDSETYGQWVGVELSAENGRQLLVPRGFLHGFVTREPDTLV 143

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
           IYK +D Y+ + +  V W D  + I W  +D     +S KD   P     ++PF+
Sbjct: 144 IYKCSDSYAPDTERPVFWADPDLAIDWG-IDPAQAILSAKDAEAPAFAAFETPFD 197


>gi|323144443|ref|ZP_08079047.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Succinatimonas hippei YIT
           12066]
 gi|322415782|gb|EFY06512.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Succinatimonas hippei YIT
           12066]
          Length = 183

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 110/173 (63%), Gaps = 3/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +I  V ++  +KF D+RGWFS+ +  S+  K +G Q  FVQ N SFS     +RG+H+Q 
Sbjct: 7   SIPEVLLITNKKFGDNRGWFSEVFRLSEFEKAIGGQYKFVQINESFSMH-NILRGIHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           P + Q KLVR ++G +FD+AVD+R+NSPT+  WV + +SA NG Q+++P GF HGF    
Sbjct: 66  P-HPQGKLVRVVSGEVFDVAVDLRKNSPTFKQWVGVTLSAQNGQQLWVPPGFGHGFFVTG 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
            +   +Y  TD+Y+ + +  +A+ D  +DI WP++   +P VSEKD+     N
Sbjct: 125 EHAHFVYACTDYYAPQTEHCIAYDDPELDIKWPIILGKMPLVSEKDRKGKAFN 177


>gi|225350728|ref|YP_002720717.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brachyspira hyodysenteriae
           WA1]
 gi|225216412|gb|ACN85145.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brachyspira hyodysenteriae
           WA1]
          Length = 192

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 114/183 (62%), Gaps = 3/183 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++IN + I + R F DSRG+F +TYS K   E G+++ FVQDN S S     +RGLH+Q+
Sbjct: 8   LDINGLFIAEPRIFGDSRGYFLETYSEKDFFEAGIKEKFVQDNQSKS-TKNVLRGLHYQK 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             Y QAKLVR + G +FD+AVD+R +SPT+G +  + ++  N  Q +IP GFAHGF+ L 
Sbjct: 67  K-YCQAKLVRVLEGEVFDVAVDLRNDSPTFGKYYGVLLTEENKKQFFIPKGFAHGFIVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            +    YK +DFY  E + G+ + DK+I+I W   DT    VS+KD  LP  ++    F 
Sbjct: 126 ESAVFAYKCSDFYHPEEEGGIIYNDKNINIDWT-CDTKDVLVSDKDLKLPEFDKNKKYFS 184

Query: 181 YDG 183
            DG
Sbjct: 185 LDG 187


>gi|23500186|ref|NP_699626.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis 1330]
 gi|161620506|ref|YP_001594392.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella canis ATCC 23365]
 gi|163844603|ref|YP_001622258.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis ATCC 23445]
 gi|254699693|ref|ZP_05161521.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis bv. 5 str. 513]
 gi|254702829|ref|ZP_05164657.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis bv. 3 str. 686]
 gi|254706050|ref|ZP_05167878.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella pinnipedialis
           M163/99/10]
 gi|254712263|ref|ZP_05174074.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ceti M644/93/1]
 gi|254715334|ref|ZP_05177145.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ceti M13/05/1]
 gi|256015220|ref|YP_003105229.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella microti CCM 4915]
 gi|256059351|ref|ZP_05449553.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella neotomae 5K33]
 gi|256157869|ref|ZP_05455787.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ceti M490/95/1]
 gi|256253170|ref|ZP_05458706.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ceti B1/94]
 gi|260167195|ref|ZP_05754006.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. F5/99]
 gi|260568258|ref|ZP_05838727.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 4 str. 40]
 gi|261217064|ref|ZP_05931345.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M13/05/1]
 gi|261220277|ref|ZP_05934558.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti B1/94]
 gi|261313487|ref|ZP_05952684.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis
           M163/99/10]
 gi|261319934|ref|ZP_05959131.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M644/93/1]
 gi|261323310|ref|ZP_05962507.1| dTDP-4-dehydrorhamnose reductase [Brucella neotomae 5K33]
 gi|261750158|ref|ZP_05993867.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 5 str. 513]
 gi|261753431|ref|ZP_05997140.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 3 str. 686]
 gi|261756599|ref|ZP_06000308.1| dTDP-4-dehydrorhamnose reductase [Brucella sp. F5/99]
 gi|265996377|ref|ZP_06108934.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M490/95/1]
 gi|23463787|gb|AAN33631.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis 1330]
 gi|161337317|gb|ABX63621.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella canis ATCC 23365]
 gi|163675326|gb|ABY39436.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella suis ATCC 23445]
 gi|255997880|gb|ACU49567.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella microti CCM 4915]
 gi|260154923|gb|EEW90004.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 4 str. 40]
 gi|260918861|gb|EEX85514.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti B1/94]
 gi|260922153|gb|EEX88721.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M13/05/1]
 gi|261292624|gb|EEX96120.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M644/93/1]
 gi|261299290|gb|EEY02787.1| dTDP-4-dehydrorhamnose reductase [Brucella neotomae 5K33]
 gi|261302513|gb|EEY06010.1| dTDP-4-dehydrorhamnose reductase [Brucella pinnipedialis
           M163/99/10]
 gi|261736583|gb|EEY24579.1| dTDP-4-dehydrorhamnose reductase [Brucella sp. F5/99]
 gi|261739911|gb|EEY27837.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 5 str. 513]
 gi|261743184|gb|EEY31110.1| dTDP-4-dehydrorhamnose reductase [Brucella suis bv. 3 str. 686]
 gi|262550674|gb|EEZ06835.1| dTDP-4-dehydrorhamnose reductase [Brucella ceti M490/95/1]
          Length = 174

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 109/172 (63%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NIN    ++  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+++ KLV C+ G ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL 
Sbjct: 66  EPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 174


>gi|76666636|emb|CAJ31157.1| probable dTDP-4-dehydrorhamnose 3,5-epimerase [uncultured
           sulfate-reducing bacterium]
          Length = 180

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 108/172 (62%), Gaps = 7/172 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPPY 63
           V +LK + FED+RG+F +T++SK L ELG+   +VQDNHS S   G +RGLH+Q  RP  
Sbjct: 4   VYLLKPQVFEDNRGFFMETFNSKGLAELGIDRQWVQDNHSRSAR-GVLRGLHYQLGRP-- 60

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            QAKLVR   GR+FD+AVDIR  SP +G W   E+S  N L ++ P GFAHGF+ L    
Sbjct: 61  -QAKLVRATRGRVFDVAVDIRPGSPHFGQWTGAELSEENKLMLFAPEGFAHGFVVLSDVA 119

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           E  YK +D+++   +  +AW D  I I WP ++   P +S KD   P L ++
Sbjct: 120 EFQYKCSDYWAPAEERAIAWNDPDIGIEWP-VEGFEPQLSGKDAANPKLAEV 170


>gi|116495477|ref|YP_807211.1| dTDP-4-dehydrorhamnose 3,5-epimerase related enzyme [Lactobacillus
           casei ATCC 334]
 gi|191638940|ref|YP_001988106.1| RmlC [Lactobacillus casei BL23]
 gi|191638981|ref|YP_001988147.1| RmlC [Lactobacillus casei BL23]
 gi|116105627|gb|ABJ70769.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei ATCC 334]
 gi|190713242|emb|CAQ67248.1| RmlC [Lactobacillus casei BL23]
 gi|190713283|emb|CAQ67289.1| RmlC [Lactobacillus casei BL23]
 gi|215272230|dbj|BAG84629.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei]
 gi|327382988|gb|AEA54464.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei LC2W]
 gi|327383034|gb|AEA54510.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei LC2W]
 gi|327386176|gb|AEA57650.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei BD-II]
 gi|327386221|gb|AEA57695.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus casei BD-II]
          Length = 190

 Score =  150 bits (379), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+       G+ + F QDN S S + G +RG+H+Q  P AQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTRDKFVAAGITNDFNQDNQSLSAEAGVLRGMHYQMAPDAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+++P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSEFNHRQLFVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV  FY+ + D G+A+ D  I I WP+    L  +S+KD+  P L   ++ F Y
Sbjct: 133 CYKVEGFYAPQSDRGIAFDDPDIGIQWPMSTDHL-IMSDKDKKHPQLKDAENNFVY 187


>gi|237799712|ref|ZP_04588173.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022567|gb|EGI02624.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 181

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 110/170 (64%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKTFGDERGFFFESFNQKAFEEVVGRPVKFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  + W D S+ I WP  +   PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLVWNDASVGIEWPFSEA--PSLSAKDQK 170


>gi|301067029|ref|YP_003789052.1| dTDP-4-dehydrorhamnose 3,5-epimerase-like enzyme [Lactobacillus
           casei str. Zhang]
 gi|300439436|gb|ADK19202.1| dTDP-4-dehydrorhamnose 3,5-epimerase related enzyme [Lactobacillus
           casei str. Zhang]
          Length = 190

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++T  F D+RG+F++TY+       G+ + F QDN S S + G +RG+H+Q  P AQ
Sbjct: 13  VKLVETDVFGDNRGFFTETYTRDKFLAAGITNDFNQDNQSLSAEAGVLRGMHYQMAPDAQ 72

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+++P GFAHGF+TL  N   
Sbjct: 73  TKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSEFNHRQLFVPKGFAHGFITLTPNVNF 132

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV  FY+ + D G+A+ D  I I WP+    L  +S+KD+  P L   ++ F Y
Sbjct: 133 CYKVEGFYAPQSDRGIAFDDPDIGIQWPMSTDHL-IMSDKDKKHPQLKDAENNFVY 187


>gi|237711069|ref|ZP_04541550.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 9_1_42FAA]
 gi|229454913|gb|EEO60634.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 9_1_42FAA]
          Length = 189

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 113/182 (62%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +  +E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEDVVIIEPRLFKDERGYFFESFSQREFEEKIRKISFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  V++E++  N LQ++IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGKHVAIELTEENHLQLFIPRGFAHGFSVLSQE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + +  +AW D  ++I W  P    IL   SEKD++   L      F+
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDSDLNINWRIPTNQIIL---SEKDKHHEKLKDASWLFD 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|148238439|ref|YP_001223826.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 7803]
 gi|147846978|emb|CAK22529.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 7803]
          Length = 205

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 111/185 (60%), Gaps = 13/185 (7%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLK----ELGLQD------VFVQDNHSFSFDCGTIRGLH 57
           ++  R F D RG+F ++++ +  +    E G+        VF QDNHS S   G +RGLH
Sbjct: 19  LITPRVFADERGFFYESWNERRFRAELIEAGVPAAEAEALVFRQDNHSRS-SRGVLRGLH 77

Query: 58  FQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
           +Q PP  Q KLVRC  G IFD+AVD+RR SPTYG WV  E+SA N  Q+++P GFAHGF+
Sbjct: 78  YQLPPEPQGKLVRCSLGAIFDVAVDLRRASPTYGQWVGAELSAANHQQLWVPVGFAHGFL 137

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL--PSVSEKDQNLPFLNQI 175
           TL    EV YK + F++ + +  + W D ++ I WPL    +  P ++ KD + P L  +
Sbjct: 138 TLTDVAEVQYKASGFWNRDCERSLRWDDSALAIAWPLEQAGVSEPLLAPKDADAPLLASL 197

Query: 176 DSPFE 180
           D+  E
Sbjct: 198 DAAAE 202


>gi|85710316|ref|ZP_01041381.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Erythrobacter sp. NAP1]
 gi|85689026|gb|EAQ29030.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Erythrobacter sp. NAP1]
          Length = 181

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 111/170 (65%), Gaps = 3/170 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ + F D RG+F ++++++   + GL   FVQDNHS S   G +RG+HFQ P   Q K
Sbjct: 13  IIEPKVFGDERGFFMESWNAQAFADAGLDIAFVQDNHSRS-QKGVLRGMHFQNPG-PQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR ++G +FD+AVD+RR+SPT+G WV +E+SA N    ++P GFAHGF+TLE NT+ +Y
Sbjct: 71  LVRVVSGAVFDVAVDLRRSSPTFGKWVGVELSAQNKRMFWVPQGFAHGFLTLEDNTDFLY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           K    Y+ + +  +AW D  + I WP  D +   +S KD+    L ++++
Sbjct: 131 KCDAPYAPQTEHSLAWDDPEVGIQWP-TDGLEVQLSSKDREGKSLGEVEA 179


>gi|257468314|ref|ZP_05632410.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium ulcerans ATCC
           49185]
 gi|317062592|ref|ZP_07927077.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688268|gb|EFS25103.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium ulcerans ATCC
           49185]
          Length = 193

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 109/169 (64%), Gaps = 6/169 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + IL+   F D RG+F +TY+ K  +E+G+ + FVQDNHS S   G +RGLHFQ   
Sbjct: 11  IEGLYILEPTIFGDERGFFLETYNKKEFEEIGIFEEFVQDNHSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR + G ++D+AVDIR+NS TYG W  +E+SA N    +IP GFAHGF+TLE  
Sbjct: 69  HPQGKLVRVLKGSVYDVAVDIRKNSSTYGKWYGIELSAENKKIFFIPKGFAHGFLTLEDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKDQ 167
           TE  YK TDFY  ++DSG+ W DK I+I W      L      +SEKD+
Sbjct: 129 TEFQYKCTDFYMPQYDSGIMWNDKEININWNFEKYGLKEEGIVLSEKDK 177


>gi|157376144|ref|YP_001474744.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sediminis HAW-EB3]
 gi|157318518|gb|ABV37616.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sediminis HAW-EB3]
          Length = 181

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 107/166 (64%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I++ + F D RG+F +T+ + L KE      FVQ+NHS S + G +RGLH+Q   
Sbjct: 8   IPDVKIIEPQVFGDERGFFMETFRTSLFKEKCGDIEFVQENHSKS-NHGILRGLHYQTEQ 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR   G +FD+AVD+R++SPTYG WV   +SA N  Q+++P GFAHGF  +  +
Sbjct: 67  -TQGKLVRVTKGEVFDVAVDLRKDSPTYGQWVGEILSAENKRQLWVPAGFAHGFYVMSED 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E +YK TD+Y+   +  + W D ++++ WP +D   P +SEKD+N
Sbjct: 126 AEFMYKCTDYYNPSAEVSIKWDDPTLNVQWPWVDKQAPLLSEKDKN 171


>gi|332879845|ref|ZP_08447534.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332682222|gb|EGJ55130.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 182

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 111/180 (61%), Gaps = 6/180 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++ + F D RG+F +++S +   E      FVQDN S S   G +RGLHFQ+P
Sbjct: 7   KIEGVVIIEPQVFFDGRGYFFESFSQQRFNEQVAPITFVQDNESKS-SYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ Q+KLVR + G++ D+AVD+RRNSPT+G + S+ ++  N  Q ++P GFAHGF  L  
Sbjct: 66  PFTQSKLVRVVKGKVLDVAVDLRRNSPTFGQYESVLLTEENKRQFFVPQGFAHGFAVLSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  ++Y+ + +  V W D SI+I W  P+ D +L   SEKD+N P L  +++ F
Sbjct: 126 EAIFQYKCDNYYAPQSEGSVRWDDPSINIDWQLPIADVLL---SEKDKNAPLLEALETIF 182


>gi|291527356|emb|CBK92942.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Eubacterium rectale M104/1]
          Length = 216

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 104/163 (63%), Gaps = 2/163 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++     D+RG+F +TY+SK ++E G+  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 26  GIEGLCIIEPTVHGDNRGYFMETYNSKDMQEAGIDRVFVQDNQSCSTK-GVLRGLHFQKE 84

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y QAKLVR + G +FD+AVD+R +S TYG W  +E++  N  Q  IP GFAHGF+ L  
Sbjct: 85  -YPQAKLVRAVKGSVFDVAVDLRSDSKTYGKWFGVELTEENKKQFLIPEGFAHGFLVLSD 143

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
             E  YKVTDF+ +  +SG+AW D +I I WP L    P  ++
Sbjct: 144 VAEFCYKVTDFWHLGDESGLAWNDPAIGIEWPQLVGEYPGSAD 186


>gi|330972799|gb|EGH72865.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 181

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 111/170 (65%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K  +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVIVFEPKTFGDDRGFFFESFNQKAFEEVVGRPVKFVQDNHSRSVK-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G +FD+AVD+R++SPT+G WV L ++A N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L  + E +YK TD+++ EH+  +AW D ++ I WP  +   PS+S KDQ 
Sbjct: 123 LSESAEFLYKTTDYWAPEHERSLAWNDATVGIDWPFGEA--PSLSAKDQK 170


>gi|146309305|ref|YP_001189770.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas mendocina ymp]
 gi|145577506|gb|ABP87038.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas mendocina ymp]
          Length = 182

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (64%), Gaps = 4/164 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++   E  G+   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPQVFGDERGFFYESFNARRFAEATGVNREFVQDNHSRSAR-GVLRGLHYQLQQ-A 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG ++D+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L    E
Sbjct: 69  QGKLVRASAGEVYDVAVDVRRSSPNFGKWVGVHLSAENKRQLWVPEGFAHGFLVLSEYAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK TD+Y+  H+  + W D  + I WP LD + P +S KDQ 
Sbjct: 129 FLYKTTDYYAPAHERCIRWDDAHLAIDWP-LDGLTPQLSAKDQQ 171


>gi|237802169|ref|ZP_04590630.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025026|gb|EGI05082.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 181

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 109/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ R F D RG+F ++++++  +E  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VVILEPRVFGDERGFFYESFNAQAFQEATGLTRHFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG++ D+AVDIRR+SP +G WV++E+SA N  Q+++P GFAHGF+ L    E
Sbjct: 69  QGKLVRVTAGKVLDVAVDIRRSSPNFGQWVAVELSAENACQLWVPEGFAHGFVVLSEQAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGQ--PSLSAKDQQGKSLKEAD 178


>gi|158521029|ref|YP_001528899.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfococcus oleovorans
           Hxd3]
 gi|158509855|gb|ABW66822.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfococcus oleovorans
           Hxd3]
          Length = 187

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 107/178 (60%), Gaps = 5/178 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  VRI++   FED+RG+F +TY  +     G+   FVQDN SFS   GT+RGLH+Q P
Sbjct: 7   DITGVRIIEPDVFEDARGFFMETYQRQRYAGYGVDVDFVQDNLSFS-SAGTLRGLHYQYP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQ KLV  I+G I+D+AVD+RR SPT+G WV   +S+ N  Q +IP GFAHGF+ +  
Sbjct: 66  -FAQEKLVHVISGEIYDVAVDVRRGSPTFGRWVGTALSSANRRQFFIPKGFAHGFLVVSD 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
              V YK  D+Y  E D  + W D ++ I W    T  P +S KD   P L  I S +
Sbjct: 125 TALVTYKCGDYYHPEADRTLRWDDPALIIDW---GTKTPLLSPKDAAAPSLKDIPSGY 179


>gi|73540421|ref|YP_294941.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia eutropha JMP134]
 gi|72117834|gb|AAZ60097.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia eutropha JMP134]
          Length = 183

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 115/166 (69%), Gaps = 5/166 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V+I++ + F D RG+F ++++++  ++ +GL+  FVQDNHS S  CG +RGLH+Q  
Sbjct: 10  IPEVKIIEPKVFGDDRGFFLESFNARAFEQAMGLKRDFVQDNHSRS-ACGVLRGLHYQIQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR +AG +FD+AVD+R++SPT+G WV + +S +N  Q+++P GFAHGF+ +  
Sbjct: 69  -HPQGKLVRVVAGEVFDVAVDLRKSSPTFGKWVGVTLSVDNKRQLWVPEGFAHGFLVMSS 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           + E +YK TD++  E++  + W D ++ I WPL  T  P ++ KD+
Sbjct: 128 SAEFLYKTTDYWYPEYERSLLWNDPTVGIEWPL--TGDPILAAKDE 171


>gi|222087846|ref|YP_002546384.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium radiobacter
           K84]
 gi|221725294|gb|ACM28450.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Agrobacterium radiobacter
           K84]
          Length = 183

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V +L+ R+F D RG F++T+     +ELG    FVQDN S S   G +RGLH+Q  P
Sbjct: 10  IPDVLLLEHREFGDDRGSFTETFRDSAFQELGFPQ-FVQDNQSRS-SKGVVRGLHYQVNP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            A  KLVRC+ GRIFD+AVD+R  SPTYG W   E++  +    Y+P GFAHGFM LE +
Sbjct: 68  NAVGKLVRCVHGRIFDVAVDLRLGSPTYGKWTGTELAGTDNHMFYVPEGFAHGFMALEDD 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           T V Y+ T ++    +  + W D  + I WP L  +L   S KD N      +D  F Y
Sbjct: 128 TLVSYRQTGYWDAASERSLLWNDPDVAIDWPKLAVLL---SPKDANATRFADVDHNFRY 183


>gi|88813324|ref|ZP_01128562.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Nitrococcus mobilis Nb-231]
 gi|88789382|gb|EAR20511.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Nitrococcus mobilis Nb-231]
          Length = 182

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 110/173 (63%), Gaps = 9/173 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M+  P R+     +K +   D+RG+F +T+  +  ++ GL   FVQDNHS S   G +RG
Sbjct: 1   MDFIPTRLPDVILIKPQVAGDARGYFMETWHERKFQDAGLDVRFVQDNHSRS-RHGILRG 59

Query: 56  LHFQ-RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           LH+Q R P  Q KLVR ++G +FD+AVD+RR+SP++G WV +E+S  N   ++IP GFAH
Sbjct: 60  LHYQIRQP--QGKLVRVVSGAVFDVAVDLRRSSPSFGQWVGVELSEENKHMLWIPPGFAH 117

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           GF     + E +YK TDF++ +H+  + W D  +DI WP+     P +SEKD+
Sbjct: 118 GFYVSAEHAEFVYKCTDFWAPQHERTIRWDDSELDIAWPIPTHAAPLLSEKDR 170


>gi|197333915|ref|YP_002154931.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio fischeri MJ11]
 gi|197315405|gb|ACH64852.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio fischeri MJ11]
          Length = 189

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 6/172 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQRPPY 63
           V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q    
Sbjct: 11  VKIIEPSVFGDERGFFMETWNQKQFEELVTGKLTQFVQDNHSKS-KKGILRGLHYQTEN- 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR I+G +FD+AVDIR+ SPT+G W+   +SA N  Q++IP GFAHGF       
Sbjct: 69  TQGKLVRVISGEVFDVAVDIRKGSPTFGQWIGEYLSAENKRQLWIPEGFAHGFYVTSEEA 128

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           E +YK TD+Y+   +  + W D +++I WPL   +LPS+S KD+     N +
Sbjct: 129 EFVYKCTDYYNPTAEVSIKWDDPTVNIEWPL--KMLPSLSNKDKKAKMFNDV 178


>gi|302337208|ref|YP_003802414.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta smaragdinae DSM
           11293]
 gi|301634393|gb|ADK79820.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta smaragdinae DSM
           11293]
          Length = 180

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 105/174 (60%), Gaps = 4/174 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ V I+K R F D RG+F +TY     +  G+   FVQDNHS+S   G +RG+HFQ+ 
Sbjct: 9   KISGVMIVKPRIFPDERGFFMETYKKSDFESAGICADFVQDNHSYS-AFGVLRGIHFQKA 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQ KLV  + G ++D+AVD+R +SPT+  WV + +++  G  +Y+P G  HGF+ L  
Sbjct: 68  SHAQGKLVHAVEGSVWDVAVDLRPSSPTFKQWVGITLNSEEGTMLYLPPGCGHGFVVLSH 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               +YK T  Y+ + D G+ W D  + + WP+     P VSEKD  LPF +++
Sbjct: 128 TVHFLYKCTTEYAPQADGGIRWNDPDLAVAWPVDH---PQVSEKDAALPFFSEV 178


>gi|265763212|ref|ZP_06091780.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
 gi|263255820|gb|EEZ27166.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
          Length = 187

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 112/181 (61%), Gaps = 6/181 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ R F+D RG+F ++++    +    Q  FVQDN S S   G IRGLHFQ+PP
Sbjct: 8   IEGLVIIEPRLFQDDRGYFFESFNQGEFESKVCQTTFVQDNESKS-SYGVIRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ+KLVR I G + D+AVDIR++SPT+G  +S+E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  FAQSKLVRVIKGAVLDVAVDIRKDSPTFGKHISVELTGDNHRQFFIPRGFAHGFCVLSKE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY  E +  +AW D  ++I+W  PL D +L   S KD+N   L ++ S   
Sbjct: 127 VVFQYKCDNFYHPESEGTIAWNDIDLNISWRIPLEDVVL---SRKDKNALPLKEMYSDVN 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|148558245|ref|YP_001257420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ovis ATCC 25840]
 gi|148369530|gb|ABQ62402.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella ovis ATCC 25840]
          Length = 174

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 109/172 (63%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NIN    ++  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNINGAWSIEPGRLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+++ KLV C+ G ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL 
Sbjct: 66  EPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 174


>gi|307293848|ref|ZP_07573692.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingobium chlorophenolicum
           L-1]
 gi|306879999|gb|EFN11216.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingobium chlorophenolicum
           L-1]
          Length = 181

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 109/170 (64%), Gaps = 3/170 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ + F D RG+F +++++   +E GL   FVQDNHS S   G +RGLHFQ P   Q K
Sbjct: 13  IIEPKVFGDDRGFFMESWNADRFREQGLDLTFVQDNHSRSAK-GVLRGLHFQNP-NPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR  AGR++D+AVD+RR+S  +G WV +E+SA N    ++P GFAHGF+TLE  T+ +Y
Sbjct: 71  LVRVTAGRVWDVAVDLRRSSRHFGKWVGVELSAENRRMFWVPPGFAHGFLTLEDGTDFLY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           K T  Y   H+  + W D ++ + WP LD I P +S KD     L +I++
Sbjct: 131 KCTGRYDPSHEHSLLWNDPTVGVDWP-LDGIEPQLSGKDVAGKPLAEIEA 179


>gi|56476693|ref|YP_158282.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Aromatoleum aromaticum EbN1]
 gi|56312736|emb|CAI07381.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Aromatoleum aromaticum EbN1]
          Length = 181

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 115/169 (68%), Gaps = 7/169 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +I  V +++ + F D+RG+F ++++++  ++  GL + FVQDNHS S   G +RGLH+Q 
Sbjct: 7   SIPDVLLIEPKVFGDARGFFFESFNARAFRDATGLDETFVQDNHSRSAR-GVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           R P  Q KLVR + G +FD+AVD+RR SP++G W  +E+S +N  Q++IP GFAHGF+ L
Sbjct: 66  RQP--QGKLVRVVRGAVFDVAVDLRRASPSFGRWAGVELSEDNHRQLWIPPGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             + + +YK TD+Y+ EH+  +AW D ++ I WPL   + P +S KD+ 
Sbjct: 124 SESADFLYKTTDYYAPEHERCLAWNDPAVGIEWPL--GVAPLLSGKDRE 170


>gi|16129978|ref|NP_416542.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89108858|ref|AP_002638.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K-12
           substr. W3110]
 gi|170081668|ref|YP_001730988.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901228|ref|YP_002927024.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli BW2952]
 gi|585830|sp|P37745|RMLC_ECOLI RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|508240|gb|AAB88401.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|510251|gb|AAC31630.1| dTDP-6-deoxy-L-xylo-4-hexulose 4-reductase [Escherichia coli str.
           K12 substr. W3110]
 gi|1736728|dbj|BAA15880.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K12
           substr. W3110]
 gi|1788350|gb|AAC75099.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K-12
           substr. MG1655]
 gi|169889503|gb|ACB03210.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli str. K-12
           substr. DH10B]
 gi|238861013|gb|ACR63011.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli BW2952]
 gi|260448862|gb|ACX39284.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli DH1]
 gi|281179137|dbj|BAI55467.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli SE15]
 gi|315136672|dbj|BAJ43831.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Escherichia coli DH1]
          Length = 185

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 109/174 (62%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ R F D RG+F ++++    +  LG    FVQDNHS S     +RGLHFQR 
Sbjct: 8   IEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRS-SKNVLRGLHFQRG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            YAQ KLVRC  G +FD+AVDIR NS ++G WV + +SA+N  Q++IP GFAHGF+ L  
Sbjct: 67  EYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHGFLVLSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E  YK T++Y  E D G+ W D+ I I WP    ++  +S KD+ L  L+++
Sbjct: 127 IAEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLI--LSPKDERLFTLDEL 178


>gi|254294496|ref|YP_003060519.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hirschia baltica ATCC 49814]
 gi|254043027|gb|ACT59822.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hirschia baltica ATCC 49814]
          Length = 176

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 105/166 (63%), Gaps = 3/166 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+  K  D RG+F++T+ +   +E G++  FVQ N SFS + GT+RG+H Q  P+A+ K
Sbjct: 13  LLEVEKRGDDRGFFTRTFCAAEFREQGIEISFVQQNSSFSAEKGTLRGMHKQNAPHAEDK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVRCI G I DI VD+R  S T+  W + E+S  N  ++ +P GF HGF TLE N EV Y
Sbjct: 73  LVRCIKGSIVDIIVDLRPESSTFKKWEAFELSETNRKELLVPRGFGHGFQTLEDNVEVTY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
            V+++Y+ E +SGV   D +  I WPL  T++   S+KD+N P   
Sbjct: 133 LVSNYYTPEAESGVRHDDPAFGIEWPLPITVM---SDKDRNWPLFE 175


>gi|218134416|ref|ZP_03463220.1| hypothetical protein BACPEC_02319 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989801|gb|EEC55812.1| hypothetical protein BACPEC_02319 [Bacteroides pectinophilus ATCC
           43243]
          Length = 183

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 104/175 (59%), Gaps = 2/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  +++++   F D+RG+F +TY+     E G+   FVQDN S S   G +RGLHFQ  
Sbjct: 10  GIEGLKVIEPAVFGDNRGYFMETYNYNDFAEAGIDCKFVQDNQSAS-KKGVLRGLHFQ-I 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G +FD+AVDIR+ SPTYG W  + +SA N  Q +IP  FAHGF+ L  
Sbjct: 68  NYPQDKLVRVVNGEVFDVAVDIRKGSPTYGQWFGVVLSAENKKQFFIPKDFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             E  YKVTDFY    + G+ W DK I I WP+ + +    SEKD   P +  ++
Sbjct: 128 YAEFCYKVTDFYHPNDEGGIIWDDKDIGIEWPVPEGMELIFSEKDTKWPGIKSLN 182


>gi|291568776|dbj|BAI91048.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arthrospira platensis
           NIES-39]
          Length = 182

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 113/174 (64%), Gaps = 9/174 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P +I     ++ + F D RG+F ++++ K+  E  G+   FVQDNHS S   G +R
Sbjct: 1   MNVIPTKIPDVFLVEPKVFGDHRGFFFESFNQKVFTEKTGVTTDFVQDNHSRS-SQGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q     Q KL+R + G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAH
Sbjct: 60  GLHYQIQ-QTQGKLLRVVLGEVFDVAVDIRKSSPTFGQWVGYYLSAENKQQLWIPPGFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           GF+      EV+YK TD+Y+ +++  + W D  I I WP L+++ P +SEKD+N
Sbjct: 119 GFLVTSPVAEVLYKTTDYYAPQYERSLLWNDPDIAIEWP-LESLEPKLSEKDKN 171


>gi|209526055|ref|ZP_03274588.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arthrospira maxima CS-328]
 gi|209493581|gb|EDZ93903.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arthrospira maxima CS-328]
          Length = 182

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 113/174 (64%), Gaps = 9/174 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P +I     ++ + F D RG+F ++++ K+  E  G+   FVQDNHS S   G +R
Sbjct: 1   MNVIPTKIPDVFLVEPKVFGDDRGFFFESFNQKVFTEKTGVTTDFVQDNHSRS-SQGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q     Q KL+R + G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAH
Sbjct: 60  GLHYQIQ-QTQGKLLRVVLGEVFDVAVDIRKSSPTFGQWVGYYLSAENKQQLWIPPGFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           GF+      EV+YK TD+Y+ +++  + W D  I I WP L+++ P +SEKD+N
Sbjct: 119 GFLVTSPVAEVLYKTTDYYAPQYERSLLWNDPDIAIEWP-LESLEPKLSEKDKN 171


>gi|332877115|ref|ZP_08444866.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332685005|gb|EGJ57851.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 190

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 112/180 (62%), Gaps = 4/180 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F D+RG+F +++S +    L     FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVVIIEPRLFNDARGYFFESFSQRDFDRLVRTVHFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGQHVAVELTEENHRQFFIPRGFAHGFSVLSPE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK  +FY+ + +  +AW D  +DI W +  D I+  +SEKD++ P L   +  F+Y
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDPDLDINWRIPSDKII--LSEKDKHHPRLKDAEWLFDY 184


>gi|160940165|ref|ZP_02087510.1| hypothetical protein CLOBOL_05054 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436745|gb|EDP14512.1| hypothetical protein CLOBOL_05054 [Clostridium bolteae ATCC
           BAA-613]
          Length = 210

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 102/167 (61%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   F+D RG+F +TY+    KE GL  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 36  DIKGLYVIEPAVFKDERGYFMETYNQNDFKEAGLGMVFVQDNQSMSVK-GVLRGLHFQKQ 94

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G ++D+AVD+R +S TYG W  + +SA N  Q YIP GFAHGF+ L  
Sbjct: 95  -YPQGKLVRVVRGTVYDVAVDLRSDSETYGKWFGVILSAENKKQFYIPEGFAHGFLVLSD 153

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
             E  YK TDFY    + G+ W D  I + WP+   +   +S+KD+ 
Sbjct: 154 EAEFAYKCTDFYHPGDEGGLLWSDPEIGVDWPIEPDMQLIISDKDRK 200


>gi|284051016|ref|ZP_06381226.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arthrospira platensis str.
           Paraca]
          Length = 182

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 113/174 (64%), Gaps = 9/174 (5%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P +I     ++ + F D RG+F ++++ K+  E  G+   FVQDNHS S   G +R
Sbjct: 1   MNVIPTKIPDVFLVEPKVFGDHRGFFFESFNQKVFTEKTGVTTDFVQDNHSRS-SQGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q     Q KL+R + G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAH
Sbjct: 60  GLHYQIQ-QTQGKLLRVVLGEVFDVAVDIRKSSPTFGQWVGYYLSAENKQQLWIPPGFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           GF+      EV+YK TD+Y+ +++  + W D  I I WP L+++ P +SEKD+N
Sbjct: 119 GFLVTSPVAEVLYKTTDYYAPQYERSLLWNDPDIAIQWP-LESLEPKLSEKDKN 171


>gi|119513382|ref|ZP_01632415.1| dTDP-4-dehydrorhamnose 3,5-epimerase-like protein [Nodularia
           spumigena CCY9414]
 gi|119461961|gb|EAW42965.1| dTDP-4-dehydrorhamnose 3,5-epimerase-like protein [Nodularia
           spumigena CCY9414]
          Length = 212

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 112/174 (64%), Gaps = 10/174 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I+ V +++ + F DSRG+F ++Y+  K   +LG+   FVQDNHS S     +RGLH+Q 
Sbjct: 38  EISEVYLIEPQVFTDSRGFFLESYNQQKFTDKLGITVNFVQDNHSAS-QQNVLRGLHYQI 96

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            +P   Q KLVR + G+IFD+AVDIR++SPT+G WV  E+SA N  Q++IP GFAHGF+ 
Sbjct: 97  IQP---QGKLVRAVVGKIFDVAVDIRKSSPTFGQWVGYELSAENKRQLWIPPGFAHGFLV 153

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPF 171
           L    EV YK TD+Y+ + D  + W D  + I WP+     P +S+KD +  PF
Sbjct: 154 LSEVAEVTYKTTDYYAAQGDRTILWNDPDLAINWPIKQP--PILSDKDNKGQPF 205


>gi|114321467|ref|YP_743150.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227861|gb|ABI57660.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 182

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 104/171 (60%), Gaps = 5/171 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-RP 61
           I  V ++K   F D RG+F +T+  +   E G+   FVQDNHS S   GT+RGLH+Q R 
Sbjct: 8   IPDVILVKPDVFGDERGFFMETWQRRKFAEGGIDHDFVQDNHSRSVK-GTLRGLHYQIRQ 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P  Q KLVR  AG +FD+AVD+RR SPT+G W    +SA+N   +++P GFAHGF     
Sbjct: 67  P--QGKLVRVTAGSVFDVAVDLRRGSPTFGQWAGEHLSADNHHMLWVPPGFAHGFYVTSE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPF 171
             +  YK +D+Y+ EH+  + W D  + I WPL D   P VSEKD Q L F
Sbjct: 125 TADFQYKCSDYYAPEHEHCIRWDDPELGIDWPLSDNGAPLVSEKDRQGLAF 175


>gi|294853750|ref|ZP_06794422.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. NVSL 07-0026]
 gi|294819405|gb|EFG36405.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. NVSL 07-0026]
          Length = 174

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 108/172 (62%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NIN    ++  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+++ KLV C+ G ++D+  D+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL 
Sbjct: 66  EPHSETKLVTCLQGIVWDVLADLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 174


>gi|253563860|ref|ZP_04841317.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_2_5]
 gi|251947636|gb|EES87918.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_2_5]
          Length = 195

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 115/189 (60%), Gaps = 12/189 (6%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE------LGLQDVFVQDNHSFSFDCGTIRG 55
            I  V +++ + F+DSRG+F +++S +   E       G   +FVQDN S S   G +RG
Sbjct: 7   TIEGVVVIEPKVFKDSRGYFVESFSQREFDEKVAIPQYGKPILFVQDNESMS-SYGVMRG 65

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQ PP+ Q+KLVRC+ G++ D+AVDIR+ SPTYG  V++E++ +N  Q+++P GFAHG
Sbjct: 66  LHFQLPPFTQSKLVRCVRGKVLDVAVDIRKGSPTYGHHVAVELTEDNHRQLFVPRGFAHG 125

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
           F  L       YK  +FY+ + D G++ +D+S+ I W  P+   IL   SEKD     L 
Sbjct: 126 FAVLSETAVFQYKCDNFYAPQADGGISIKDESLGIDWCIPMDKVIL---SEKDTQHECLK 182

Query: 174 QIDSPFEYD 182
               PF+ +
Sbjct: 183 DFTPPFDIE 191


>gi|326336356|ref|ZP_08202527.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325691530|gb|EGD33498.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 188

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 108/175 (61%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ + F D RG+F +++S K   E      FVQDN S S   G +RGLHFQR P
Sbjct: 8   IEGVVIIEPKVFPDERGYFFESFSQKKFVENICNTTFVQDNESKS-SYGVLRGLHFQRAP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q+KLVR + G ++DIAVDIR+ SPT+G ++ +E++  N  Q++IP GFAHGF+ L   
Sbjct: 67  YTQSKLVRVVQGVVWDIAVDIRKGSPTFGKYIGVELTEENKRQLFIPRGFAHGFVVLSPE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQI 175
               YK   FY+  H+ GV W D  I I W  P  D IL   S+KD++ P L+++
Sbjct: 127 AIFQYKCDAFYAPTHEGGVLWNDPEIGIDWRIPPQDIIL---SQKDEHNPLLHEV 178


>gi|148380673|ref|YP_001255214.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum A str.
           ATCC 3502]
 gi|153933465|ref|YP_001384957.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936831|ref|YP_001388427.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum A str.
           Hall]
 gi|148290157|emb|CAL84276.1| probable DTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152929509|gb|ABS35009.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum A str.
           ATCC 19397]
 gi|152932745|gb|ABS38244.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum A str.
           Hall]
          Length = 177

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 104/163 (63%), Gaps = 2/163 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V IL+    ED RG+F++T+  +  K  GL    VQ N SF+   GT+RG+H+Q PPY +
Sbjct: 11  VYILEIEPIEDERGFFARTWCEEEFKVYGLNSNLVQCNISFNKRRGTLRGMHYQIPPYEE 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLVRC  G I+D+ +D+R NS T+  W ++E++  N   +YIP GFAHGF TLE +TEV
Sbjct: 71  AKLVRCTKGSIYDVIIDLRPNSKTFKQWTAIELTDENRKMLYIPEGFAHGFQTLEDDTEV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            Y+++ FY  E   G+ W D +  + WP+   ++  +S KD+N
Sbjct: 131 FYQMSQFYHPECARGIRWDDLTFSVDWPVRGDVI--ISYKDKN 171


>gi|116749695|ref|YP_846382.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698759|gb|ABK17947.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 184

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 112/189 (59%), Gaps = 18/189 (9%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+ R F DSRG+F ++Y+   L++ G+   FVQDNHS S   G +RGLH+Q   +AQ K
Sbjct: 14  VLEPRVFGDSRGFFFESYNQNTLRQWGIVLPFVQDNHSGSRK-GVLRGLHYQVG-HAQGK 71

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           L+R +AG +FD+AVD+R  SP +G W  + +SA    QIYIP GFAHGF+T+    EV+Y
Sbjct: 72  LIRVVAGEVFDVAVDLRTKSPAFGRWFGMILSAAERKQIYIPPGFAHGFLTVSDWAEVLY 131

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLL 187
           K TDFY+ E +  + W D  I I WPL     P++S KD               +GLPL 
Sbjct: 132 KTTDFYAPECERCIIWNDPDIGIDWPL--ECPPTLSSKDS--------------EGLPLS 175

Query: 188 SLNMERDLL 196
             +   DL 
Sbjct: 176 KADRYEDLF 184


>gi|148241181|ref|YP_001226338.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RCC307]
 gi|147849491|emb|CAK26985.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RCC307]
          Length = 193

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 103/168 (61%), Gaps = 3/168 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  R F D RGWF ++++ +   E   + V F QDNHS S   G +RGLH+Q PP  QA
Sbjct: 19  LITPRVFGDERGWFFESWNQRRFDEAAGEAVTFAQDNHSRSAQ-GVLRGLHYQLPPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G IFD+ VD+R++SPT G WV  ++SA N  Q+++P GFAHGF+TL    EV 
Sbjct: 78  KLVRVTVGEIFDVVVDLRQSSPTCGQWVGAQLSAENHQQLWVPEGFAHGFLTLSAVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           YK   F++   +  + W D ++ I WP L+ +   VSEKD   P L Q
Sbjct: 138 YKTRGFWNKGCERAIRWDDPALAIAWP-LEGLTVQVSEKDGLAPSLAQ 184


>gi|148557436|ref|YP_001265018.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas wittichii RW1]
 gi|148502626|gb|ABQ70880.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas wittichii RW1]
          Length = 182

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 107/177 (60%), Gaps = 3/177 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +   R+++     D RG F++T+  +  +  GL   FVQ N S S   GTIRG+H+QRP
Sbjct: 7   TLKDARLIEVEPRGDERGMFARTFCRQEFEAHGLLTDFVQQNMSVSAQAGTIRGMHYQRP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ +AKLVRC+ GRI D+ VD+R  SPTY      E+SA+N  Q+Y+P GFAH F TL  
Sbjct: 67  PFTEAKLVRCVRGRILDVIVDMRSGSPTYLRHEGFELSADNRRQLYVPPGFAHSFQTLVD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP 178
           + EV Y VT  Y+ + + GV + D  + I+WPL  T   ++S+KD   P +++   P
Sbjct: 127 DIEVSYLVTAPYTPDAEGGVRYSDPLLAISWPLPVT---TISDKDAGWPLIDRSAEP 180


>gi|291548483|emb|CBL21591.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus sp. SR1/5]
          Length = 185

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 103/166 (62%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  +++++   F DSRG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ  
Sbjct: 11  DIEGLKVIEPTVFGDSRGYFMETYNYNDFKEAGIDVEFVQDNQSSS-RYGVLRGLHFQ-I 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G +FD+AVD+R  S T+G W  + +SA N  Q +IP GFAHGF+ L  
Sbjct: 69  SYPQDKLVRVVNGEVFDVAVDLREGSKTFGKWYGVVLSAENKKQFFIPKGFAHGFLVLSE 128

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           N E  YK +DFY    + G+ W DK I++ WP+ + +    S+KDQ
Sbjct: 129 NAEFTYKCSDFYHPNDEGGLIWNDKDINVEWPIPEGMELIFSDKDQ 174


>gi|163859123|ref|YP_001633421.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella petrii DSM 12804]
 gi|163262851|emb|CAP45154.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella petrii]
          Length = 181

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 111/179 (62%), Gaps = 7/179 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           ++I  V +++     D+RG+F ++Y +++L   LG   +FVQDN S S     +RGLH+Q
Sbjct: 6   LSIPDVLLIEPEVHADARGYFFESYNAARLQAALGRAPMFVQDNQSRSLR-HVVRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            R P  QAKLVR +AG +FD+AVD+RR SPT+G W    +SA N  Q+++P GFAHGFM 
Sbjct: 65  IRQP--QAKLVRVVAGEVFDVAVDLRRASPTFGQWAGAVLSAENKCQLWVPEGFAHGFMA 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           L    E +YK +D+Y+  H+  V W D  I I WP  D ++  VSEKD+    L   D+
Sbjct: 123 LSDVAETLYKASDYYAPAHERCVRWDDPDIGIAWPARDDVI--VSEKDRRGVALRDADT 179


>gi|254286303|ref|ZP_04961262.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae AM-19226]
 gi|150423718|gb|EDN15660.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae AM-19226]
          Length = 182

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 111/177 (62%), Gaps = 6/177 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPAVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  -TENTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               E +YK TDFY+ + +  + W D +I I WP+ +T  P +SEKD     L  ++
Sbjct: 125 SDEAEFVYKCTDFYNPKAEHSIRWDDDTIGIKWPITET--PLLSEKDSVGKLLKDVE 179


>gi|332142156|ref|YP_004427894.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552178|gb|AEA98896.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 181

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 114/178 (64%), Gaps = 6/178 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+I++ + F D RG+F +T+ +   K+      FVQDNHS S   G +RGLH+Q  
Sbjct: 7   DIPDVKIIEPKVFGDERGFFLETFRTDWFKKECADVDFVQDNHSKS-SQGILRGLHYQIE 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G ++D+AVD+R++SPTYG WV + +SA N  Q+++P GFAHGF     
Sbjct: 66  Q-TQGKLVRVVSGEVYDVAVDMRKDSPTYGKWVGVTLSAENKRQLWVPAGFAHGFYVTSE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPFLNQIDSP 178
           N E +YK TD+Y  E +  V + D +++I WPL++   PS+S KD+  L F   +D+P
Sbjct: 125 NAEFVYKCTDYYHPESEISVKYNDSTLNIDWPLVNGEKPSLSGKDEAGLAF---VDAP 179


>gi|288942437|ref|YP_003444677.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Allochromatium vinosum DSM
           180]
 gi|288897809|gb|ADC63645.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Allochromatium vinosum DSM
           180]
          Length = 189

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 104/173 (60%), Gaps = 3/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V IL+ + + D RG+F +TY +    ELG+    VQDN SFS   G +RGLH Q P 
Sbjct: 8   IPGVLILEPKVWGDERGYFLETYRANQYAELGIPAPLVQDNQSFS-RRGVLRGLHAQHP- 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLV+ +AG +FD+AVDIRR SP +G WV + +S  N  Q +IP GFAHGF+    N
Sbjct: 66  RAQGKLVQVLAGEVFDVAVDIRRGSPHFGHWVGVTLSGENKRQFWIPPGFAHGFLVTGEN 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              +YK TD+YS E +  V W D  + I WPL   + P +S KD++   L  I
Sbjct: 126 ALFVYKNTDYYSPETEFSVRWDDPDLGIDWPLA-GMTPELSAKDRDAARLRDI 177


>gi|16331184|ref|NP_441912.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechocystis sp. PCC 6803]
 gi|1653678|dbj|BAA18590.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechocystis sp. PCC 6803]
          Length = 182

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 112/173 (64%), Gaps = 10/173 (5%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           MN+ P     V IL+ + F D RG+F ++Y+ K+ ++ +G++  FVQDNHSFS   G +R
Sbjct: 1   MNVIPTTIADVLILEPKVFGDERGFFFESYNDKVFQQAVGIEPHFVQDNHSFS-RQGVVR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q   + Q KLVR   G IFD+AVD+RRNSP++G WV   ++ +N  Q++IP GFAH
Sbjct: 60  GLHYQIQ-HPQGKLVRVARGEIFDVAVDLRRNSPSFGQWVGCVLNDHNKRQLWIPAGFAH 118

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           GF  L    EV+YK TD+Y+  ++  + W D +I I W L  T  P +S KDQ
Sbjct: 119 GFAVLSPEAEVLYKATDYYAPSYERTLLWNDPAIGIDWSL--TTTPLLSLKDQ 169


>gi|237808785|ref|YP_002893225.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Tolumonas auensis DSM 9187]
 gi|237501046|gb|ACQ93639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Tolumonas auensis DSM 9187]
          Length = 182

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 105/165 (63%), Gaps = 2/165 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+I++   F D RG+F +T+  +   EL  +  FVQDNHS S   G +RGLH+Q  
Sbjct: 7   SIPDVKIIEPAVFGDERGFFMETWQEQKFNELVCERRFVQDNHSKSRQ-GILRGLHYQ-T 64

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVR IAG +FD+AVDIRR+SPT+G  V + +SA N  Q+++P GFAHGF     
Sbjct: 65  EQAQGKLVRVIAGEVFDVAVDIRRSSPTFGQSVGVLLSAENKRQLWVPEGFAHGFYVTTE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             E +YK T++Y+   +  + W D  ++I WPL+D   PS+S KD
Sbjct: 125 TAEFVYKCTNYYNPSAEHSIRWNDPELNIQWPLVDGQQPSLSAKD 169


>gi|124265818|ref|YP_001019822.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylibium petroleiphilum
           PM1]
 gi|124258593|gb|ABM93587.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylibium petroleiphilum
           PM1]
          Length = 184

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 8/186 (4%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           M ++P     V + +   F D+RG+  ++++ +  +  +G    FV D HS S   G +R
Sbjct: 1   MKVSPTALPEVLLFEPDMFRDARGFVVESFNQRAFEAAVGHAANFVLDVHSRS-QRGVLR 59

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+QRPP+ QAKLVR   G ++D+AVD+RR+S  +G W  +E+SA    Q++IP GFAH
Sbjct: 60  GLHYQRPPHTQAKLVRVSVGSVYDVAVDLRRSSRCFGQWTGIELSAERAQQLWIPQGFAH 119

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           GF+ L  + EV YK T++Y    +  + W D  IDI WP LD I P +S KD   P L Q
Sbjct: 120 GFLVLSESAEVQYKATNYYESHAEGAIRWDDPLIDIKWPALD-IQPLLSLKDAAAPTLAQ 178

Query: 175 IDSPFE 180
               FE
Sbjct: 179 ASVLFE 184


>gi|327482466|gb|AEA85776.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas stutzeri DSM
           4166]
          Length = 181

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 109/173 (63%), Gaps = 6/173 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           ++I  V +L  R F D RG+F ++++ +  ++ +G    FVQDNHS S     +RGLH+Q
Sbjct: 6   LDIPEVLLLVPRVFGDERGFFFESFNQRTFEQAIGSPASFVQDNHSRSAR-NVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR + G ++D+AVDIRR+SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 65  IA-QPQGKLVRVVVGEVYDVAVDIRRSSPTFGKWVGAILSAENNHQLWIPQGFAHGFLVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPF 171
               E +YK TD+Y+ EH+  +AW D  + I WPL     PS+S KD Q LP 
Sbjct: 124 SETAEFLYKTTDYYAPEHERCIAWNDPHLAIQWPLEQA--PSLSNKDSQGLPL 174


>gi|222109772|ref|YP_002552036.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Acidovorax ebreus TPSY]
 gi|221729216|gb|ACM32036.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax ebreus TPSY]
          Length = 181

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 115/169 (68%), Gaps = 7/169 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F ++++ K   E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPEVVLIEPQVFGDARGFFFESFNQKTFNEATGTNHQFVQDNHSRS-SQGVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR   G+++D+AVDIR++SPT+G WV  E+S +N  Q+++P GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVARGKVWDVAVDIRKSSPTFGQWVGAELSEDNQHQLWVPPGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           L  + + +YK TD+Y+ EH+  +AW D+++ I+WP+  +I P +S KDQ
Sbjct: 123 LSESADFLYKTTDYYAPEHERCIAWNDEALTISWPV--SITPILSAKDQ 169


>gi|285808321|gb|ADC35851.1| dTDP-4-dehydrorhamnose 35-epimerase [uncultured bacterium 92]
          Length = 180

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 106/175 (60%), Gaps = 3/175 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +++  + +++ + FED RG+F +TY S      G+     Q+NHS S   GT+RGLH QR
Sbjct: 8   LDLPDIILIEPKVFEDPRGFFMETYKSSDFTAAGITAPLKQENHSRSIR-GTLRGLHAQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KL+  + G IFD+A+DIRR SPT+G W +  +S  N  Q++IP G+AHGF  L 
Sbjct: 67  APKAQGKLISVLEGEIFDVALDIRRESPTFGRWTTATLSRANRYQLFIPPGYAHGFAVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              EV+YK T+ Y+ E + GV W D  + I WPL     P +S +D++ P L  +
Sbjct: 127 DVAEVVYKTTEEYAPELEYGVRWDDPELAIPWPLRGE--PILSSRDRSWPRLRDL 179


>gi|227874476|ref|ZP_03992651.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oribacterium sinus F0268]
 gi|227839665|gb|EEJ50120.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oribacterium sinus F0268]
          Length = 246

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (62%), Gaps = 2/152 (1%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           +DSRG+F ++Y+ +  +E GL   FVQDN S S   G +RGLHFQ+  Y Q KLVR + G
Sbjct: 69  QDSRGYFMESYNERDFQEQGLNLRFVQDNQSMSVK-GVLRGLHFQKQ-YPQGKLVRVLKG 126

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
           R++D+AVD+R+NS TYG    + +S  N    YIP GFAHGF+ L    E  YKVTDFY 
Sbjct: 127 RVYDVAVDLRKNSKTYGKHFGITLSEENKKMFYIPEGFAHGFLVLSDTAEFAYKVTDFYH 186

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              + G+AW D SI I WP L       ++KD
Sbjct: 187 PGDEGGLAWNDPSIGIRWPELKGTYAGNAKKD 218


>gi|154505986|ref|ZP_02042724.1| hypothetical protein RUMGNA_03528 [Ruminococcus gnavus ATCC 29149]
 gi|153793485|gb|EDN75905.1| hypothetical protein RUMGNA_03528 [Ruminococcus gnavus ATCC 29149]
          Length = 183

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 106/175 (60%), Gaps = 2/175 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  ++++    F D RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ   
Sbjct: 11  IEGLKVITPAVFGDERGYFMETYNYNDYKEAGIDMEFVQDNQSSS-KKGVLRGLHFQ-IN 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR ++G +FD+AVD+R+ S TYG W  + +SA N  Q +IP  FAHGF+ L  +
Sbjct: 69  YPQDKLVRVVSGEVFDVAVDLRKGSKTYGQWYGVVLSAENKKQFFIPKDFAHGFVVLSDS 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            E  YK TDFY    + G+AW D  I I WP+ + +  ++SEKDQ    + +++ 
Sbjct: 129 AEFAYKCTDFYHPNDEGGLAWNDPDIGIEWPIPEDMELTISEKDQKWGGIKELNK 183


>gi|87201249|ref|YP_498506.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136930|gb|ABD27672.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 181

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 105/161 (65%), Gaps = 3/161 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +L+ R F D RG+F ++++++   + GL   FVQDNHS S   G +RG+HFQ P   Q K
Sbjct: 13  VLEPRVFGDERGFFMESWNAEAFAKAGLDLPFVQDNHSRS-QKGVLRGMHFQNP-GPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + G +FD  VD+R++SPT+G W  + +SA N    ++P GFAHGF+TLE +T+ +Y
Sbjct: 71  LVRVVRGAVFDAVVDLRKSSPTFGKWTGVVLSAENKRMFWVPEGFAHGFLTLEDDTDFLY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           K T  Y+ +H+  +AW D  + I WP LD I P +S KD +
Sbjct: 131 KCTAPYAPQHECSLAWDDPDVGIDWP-LDGIEPKLSAKDAD 170


>gi|301162535|emb|CBW22081.1| putative LPS biosynthesis related dTDP-4-dehydrorhamnose
           3,5-epimerase [Bacteroides fragilis 638R]
          Length = 195

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 113/187 (60%), Gaps = 12/187 (6%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE------LGLQDVFVQDNHSFSFDCGTIRG 55
            I  V +++ + F+DSRG+F +++S +   E       G   +FVQDN S S   G +RG
Sbjct: 7   TIEGVVVIEPKVFKDSRGYFVESFSQREFDEKVAIPQYGKPILFVQDNESMS-SYGVMRG 65

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQ PP+ Q+KLVRC+ G++ D+AVDIR+ SPTYG  V++E++ +N  Q ++P GFAHG
Sbjct: 66  LHFQLPPFTQSKLVRCVRGKVLDVAVDIRKGSPTYGHHVAVELTEDNHRQFFVPRGFAHG 125

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
           F  L       YK  +FY+ + D G++ +D+S+ I W  P+   IL   SEKD     L 
Sbjct: 126 FAVLSETAVFQYKCDNFYAPQADGGISIKDESLGIDWCIPMDKVIL---SEKDTQHECLK 182

Query: 174 QIDSPFE 180
               PF+
Sbjct: 183 DFTPPFD 189


>gi|121533495|ref|ZP_01665323.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosinus carboxydivorans
           Nor1]
 gi|121308054|gb|EAX48968.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosinus carboxydivorans
           Nor1]
          Length = 186

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 108/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++   + D+RG+F +T+++   +E GL + FVQDN SFS   G +RGLHFQ P   Q
Sbjct: 11  VLLIEPDVYGDNRGYFLETWNAARYREYGLPEKFVQDNLSFS-RRGVLRGLHFQNP-NPQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV  I G +FD+AVDIR  SPT+G WV + +S++N  Q+YIP GFAHGF  L      
Sbjct: 69  GKLVYVIQGEVFDVAVDIRPGSPTFGQWVGVTLSSDNKRQLYIPEGFAHGFCVLSDTALF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            YK TDFY+ + + G+ W D  I I WP+ +   P +S+KD+  P L  I S
Sbjct: 129 AYKCTDFYNPQAEGGIIWNDFDIGIAWPVSE---PIISDKDKANPRLRDIPS 177


>gi|239993213|ref|ZP_04713737.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Alteromonas macleodii
           ATCC 27126]
          Length = 181

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+I++ + F D RG+F +T+ +   K+      FVQDNHS S   G +RGLH+Q  
Sbjct: 7   DIPDVKIIEPKVFGDERGFFLETFRTDWFKKECADVDFVQDNHSKS-SQGILRGLHYQME 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G ++D+AVD+R++SPTYG WV + +SA N  Q+++P GFAHGF     
Sbjct: 66  Q-TQGKLVRVVSGEVYDVAVDMRKDSPTYGKWVGVTLSAENKRQLWVPAGFAHGFYVTSE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPFLN 173
           + E +YK TD+Y  E +  V + D +++I WPL++   PS+S KD+  L F+N
Sbjct: 125 SAEFVYKCTDYYHPESEISVKYDDPTLNIDWPLVNGEKPSLSGKDEAGLAFVN 177


>gi|302348457|ref|YP_003816095.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidilobus saccharovorans
           345-15]
 gi|302328869|gb|ADL19064.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidilobus saccharovorans
           345-15]
          Length = 185

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 111/174 (63%), Gaps = 4/174 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++K + F D RG+F +T+ +K  ++ G++   VQ+N S+S   G IRGLH+QR
Sbjct: 8   LDIPDVVLVKPKVFRDQRGYFMETFVAKAFEQAGVKFNVVQENQSYS-RRGVIRGLHYQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             +AQAK+VR + G I+D+AVDIR  SPT+G  V++ +S +NG  +YIP GFAHGF  L 
Sbjct: 67  GQWAQAKIVRAVKGEIYDVAVDIRPWSPTFGKHVAVRLSEDNGYALYIPRGFAHGFQVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
               V+Y V + Y+ + + G+ W D  I I+WP+   +L   SEKD   P L +
Sbjct: 127 EYAIVVYLVDNDYAPQAEGGIRWDDSDIAISWPISGPVL---SEKDARWPTLRE 177


>gi|227534051|ref|ZP_03964100.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|227188323|gb|EEI68390.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
          Length = 195

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V++++T  F D+RG+F++TY+ +   E G+ + F QDN S S + G +RGLH+Q   
Sbjct: 15  LKDVKLVETDVFGDNRGFFTETYTREKFIEAGITNDFNQDNQSLSAEAGVLRGLHYQYGK 74

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLVR + G + D+ VDIR+ SPTYG W    +S  N  Q+ +P GFAHGF+TL  N
Sbjct: 75  DAQTKLVRVVTGVVEDVLVDIRKGSPTYGQWEGYILSEFNHRQLLVPKGFAHGFITLTNN 134

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YKV  +Y+ + D G+A+ D  + I WP+    L  +SEKD + P L   D+ F Y
Sbjct: 135 VNFCYKVEGYYAPDADRGIAFDDPDLGIDWPMSTDHL-IMSEKDLHHPQLKDADNNFVY 192


>gi|75909560|ref|YP_323856.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anabaena variabilis ATCC
           29413]
 gi|75703285|gb|ABA22961.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Anabaena variabilis ATCC
           29413]
          Length = 181

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 109/167 (65%), Gaps = 9/167 (5%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-- 59
           I+ + +L+ + F DSRG+F ++Y+ +    +LG+   FVQDNHSFS     +RGLH+Q  
Sbjct: 8   ISDILLLEPQVFTDSRGFFFESYNQQNFTDKLGITVNFVQDNHSFS-QHNVLRGLHYQII 66

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           +P   Q KLVR I G IFD+AVDIR++SPT+G WV  E+SA N  Q++IP GFAHGF+ L
Sbjct: 67  QP---QGKLVRAIVGTIFDVAVDIRKSSPTFGQWVGYELSAENKRQLWIPPGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               EV+YK TD+Y+   D  + W D  + I WPL +   P +S KD
Sbjct: 124 SEVAEVVYKTTDYYAPGGDRTILWNDPDLAINWPLKEP--PILSAKD 168


>gi|312113624|ref|YP_004011220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218753|gb|ADP70121.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 183

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 3/172 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++   F D RG+F++T+ ++  +  GL   FVQ + S +   GT+RG+HFQ PP+ + K
Sbjct: 13  MIEPEPFRDERGFFARTFCTREFEARGLVCNFVQHSISSTIRKGTVRGMHFQTPPHGEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           +V C  G IFD+ VD+RR +PT+  W   E++A N  ++YIP GFAHGF +L  + EV Y
Sbjct: 73  VVTCTRGAIFDVIVDLRRAAPTFLRWQGFELTAENRRRLYIPEGFAHGFQSLTDDVEVSY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            ++ FY+ E   GV   D  I I WPL    + S+SEKD+N P  N   +PF
Sbjct: 133 LISAFYAPESAGGVPHDDPLIGIEWPL---SISSISEKDRNWPPFNASAAPF 181


>gi|311109417|ref|YP_003982270.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Achromobacter xylosoxidans
           A8]
 gi|310764106|gb|ADP19555.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Achromobacter xylosoxidans
           A8]
          Length = 180

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 111/175 (63%), Gaps = 6/175 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +L+ R   D RG+F ++++  + +   GLQ  FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVLLLEPRVLGDERGFFFESFNQAVFEAATGLQRNFVQDNHSRSAR-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KL+R  AG IFD+AVD+RR+SP++G WV   +SA N  Q++IP GFAHGF+TL
Sbjct: 65  VE-QPQGKLMRVCAGEIFDVAVDLRRDSPSFGQWVGTLLSAENKRQVWIPEGFAHGFLTL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPFLN 173
               EV+YK TD+Y+ +H+  + W D  + I WP      P +SEKD+N  PF +
Sbjct: 124 SDYAEVLYKTTDYYAPQHERCIRWDDPQLAIAWPCQQP--PLLSEKDRNGAPFAD 176


>gi|206601950|gb|EDZ38432.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 183

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F +++ +K    LG+  +FVQDNHS S   G +RGLHFQ+  + Q KLVR ++G 
Sbjct: 21  DERGFFLESFHAKKFAALGIPQLFVQDNHSRS-ARGVLRGLHFQKR-HPQGKLVRVLSGS 78

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R  SPT+G W  L +SA +   +Y+P G AHGF+ LE  TE+ YK TDFY  
Sbjct: 79  LFDVAVDLRHGSPTFGHWFGLTLSAGDPEFLYLPEGMAHGFLALEDRTELFYKCTDFYDP 138

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             + G+ W D +I I WP   ++L   S KD   P L +I
Sbjct: 139 ADEGGLRWNDPAIGIAWPERPSVL---SPKDAAFPVLAEI 175


>gi|294783375|ref|ZP_06748699.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 1_1_41FAA]
 gi|294480253|gb|EFG28030.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. 1_1_41FAA]
          Length = 187

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 112/174 (64%), Gaps = 6/174 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + FEDSRG+F ++Y+    KELG+ ++FVQDN S S   G +RGLHFQ+  
Sbjct: 8   IKNLLLIEPKVFEDSRGFFIESYNYNTFKELGINNIFVQDNFSKS-SKGVLRGLHFQKGE 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQAKLV  + G + D+ VD+R++S T+G    +E++  N   ++IP GFAHGF+TLE N
Sbjct: 67  YAQAKLVNVLRGAVLDVTVDLRKDSETFGKCFIIELNEKNKRMLFIPRGFAHGFLTLEDN 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
           TE  YK  +FY+ + + G+ W D  ++I W L    +      +SEKD +N+ F
Sbjct: 127 TEFFYKCDNFYNPKSEVGIIWNDIDLNIDWNLDKYNIKEDELIISEKDKKNITF 180


>gi|46445758|ref|YP_007123.1| dTDP-4-dehydrorhamnose 3,5-epimerase, rfbC [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46399399|emb|CAF22848.1| probable dTDP-4-dehydrorhamnose 3,5-epimerase, rfbC [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 184

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 107/170 (62%), Gaps = 5/170 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + +  ++++K   F+D+RG+F +++   L +++G+Q+ F+QDNHSFS   G IRG+HFQ 
Sbjct: 6   LQLKGLKLVKPNVFKDNRGFFLESFQQPLYQKMGIQETFLQDNHSFS-QKGCIRGMHFQS 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  QAKLVR   G+I+D+AVDIR  SPT+G W  + +      Q++IP GFAHGF  L 
Sbjct: 65  FP-GQAKLVRVAVGKIYDVAVDIRPESPTFGQWEGIILDDKKHHQLFIPVGFAHGFCVLS 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
               V+YKV+  Y   ++ G  W D  ++I WP+     P VSE+D+  P
Sbjct: 124 QEAHVMYKVSTPYDPLYEKGFRWNDSQLNIQWPIEQ---PIVSERDKQSP 170


>gi|189500820|ref|YP_001960290.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium phaeobacteroides
           BS1]
 gi|189496261|gb|ACE04809.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium phaeobacteroides
           BS1]
          Length = 201

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 114/180 (63%), Gaps = 3/180 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V + + R F DSRG+F +++   +L+E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 10  IPDVLVFEPRVFGDSRGYFFESFRKDILQEHVGKVDFVQDNQSKS-GYGVLRGLHFQKPP 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q+KLVR IAG + D+AVDIR  SP YG  V++++ +     ++IP GFAHGF+ L   
Sbjct: 69  FTQSKLVRVIAGAVLDVAVDIREGSPWYGRHVAVKLDSERNNMLWIPQGFAHGFIVLSKE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
               YK  ++Y+ ++D+G+ W DK++ I W L +  +  VS+KD +LPFL +    F YD
Sbjct: 129 AIFSYKCDNYYAPDYDAGIRWNDKALGIDWTLPEEDI-QVSDKDASLPFLKEA-YHFSYD 186


>gi|301060779|ref|ZP_07201594.1| dTDP-4-dehydrorhamnose 3,5-epimerase [delta proteobacterium NaphS2]
 gi|300445176|gb|EFK09126.1| dTDP-4-dehydrorhamnose 3,5-epimerase [delta proteobacterium NaphS2]
          Length = 187

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 104/171 (60%), Gaps = 5/171 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +++ R FED RG+F +T+ S+   ++G+   F+QDNHS S   GT+RGLH+Q     Q
Sbjct: 13  VILIEPRVFEDDRGFFMETFHSEKYAKMGMSKPFLQDNHSHS-RRGTLRGLHYQLE-NPQ 70

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV  + G IFD+AVDIR  SP +G W    +S  N  Q+Y+P GFAHGF  L    +V
Sbjct: 71  GKLVYVVRGEIFDVAVDIRAGSPDFGKWTGNLLSEKNRRQLYVPGGFAHGFCVLSETADV 130

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           IYK TD Y+   + GV W D +++I WPL   IL   S+KD   P L  ID
Sbjct: 131 IYKCTDHYAPGDEYGVFWADNAVNIKWPLARPIL---SKKDSENPLLADID 178


>gi|115374685|ref|ZP_01461963.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stigmatella aurantiaca
           DW4/3-1]
 gi|310820811|ref|YP_003953169.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115368353|gb|EAU67310.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309393883|gb|ADO71342.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 184

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 112/183 (61%), Gaps = 8/183 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V +++ + F D RG+F +T+ +K   + G+   FVQDN+S S   GT+RGLHFQ P 
Sbjct: 8   IPGVLLIEPKVFGDDRGFFLETFHAKRYADAGIPGPFVQDNYSRSAR-GTLRGLHFQEP- 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ KLV+ +AG ++D+AVD+RR SPT+G WV +E+SA N  Q+++P GFAHGF      
Sbjct: 66  QAQGKLVQVVAGAVYDVAVDVRRGSPTFGKWVGVELSAENRRQLWVPPGFAHGFCVTSEF 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF--E 180
            +  YK T  Y+ E++  + W D  + I WPL  +  P +S KD   P L   D+P    
Sbjct: 126 ADFQYKCTALYAPENERSILWNDPELAIPWPL--SGAPKLSAKDAAAPRLK--DAPLLPA 181

Query: 181 YDG 183
           Y+G
Sbjct: 182 YEG 184


>gi|124515990|gb|EAY57499.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Leptospirillum rubarum]
          Length = 183

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 107/175 (61%), Gaps = 8/175 (4%)

Query: 4   NPVR-ILKTRK--FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            P+R +L+ R     D RG+F +++ +K    LG+  +FVQDNHS S   G +RGLHFQ+
Sbjct: 6   TPIRGLLRIRPDVHGDERGFFLESFHAKKFAALGIPHLFVQDNHSRS-ARGVLRGLHFQK 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             + Q KLVR ++G +FD+AVD+R  SPT+G W  L +SA +   +Y+P G AHGF+ LE
Sbjct: 65  R-HPQGKLVRVLSGSLFDVAVDLRHGSPTFGHWFGLTLSAGDPEFLYLPEGMAHGFLALE 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             TE+ YK TDFY    + G+ W D +I I WP    +L   S KD   P L +I
Sbjct: 124 DRTELFYKCTDFYDPADEGGLRWNDPAIGIAWPETPAVL---SPKDAAFPVLAKI 175


>gi|291525903|emb|CBK91490.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Eubacterium rectale DSM
           17629]
          Length = 202

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 103/163 (63%), Gaps = 2/163 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++     D+RG+F +TY+S  ++E G+  VFVQDN S S   G +RGLHFQ+ 
Sbjct: 12  GIEGLCIIEPTVHGDNRGYFMETYNSNDMQEAGIDRVFVQDNQSCSTK-GVLRGLHFQKE 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y QAKLVR + G +FD+AVD+R +S TYG W  +E++  N  Q  IP GFAHGF+ L  
Sbjct: 71  -YPQAKLVRAVKGSVFDVAVDLRSDSKTYGKWFGVELTEENKKQFLIPEGFAHGFLVLSD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
             E  YKVTDF+ +  +SG+AW D +I I WP L    P  ++
Sbjct: 130 VAEFCYKVTDFWHLGDESGLAWNDPAIGIEWPQLVGEYPGSAD 172


>gi|17231981|ref|NP_488529.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nostoc sp. PCC 7120]
 gi|17133625|dbj|BAB76188.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nostoc sp. PCC 7120]
          Length = 181

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 110/173 (63%), Gaps = 10/173 (5%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-- 59
           I  + +L+ + F DSRG F ++Y+ +    +LG+   FVQDNHSFS     +RGLH+Q  
Sbjct: 8   IPAISLLEPQVFSDSRGLFFESYNQQNFTDKLGITVNFVQDNHSFS-QHNVLRGLHYQII 66

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           +P   Q KLVR + G IFD+AVDIR++SP++G WV  E+SA N  Q+++P GFAHGF+ L
Sbjct: 67  QP---QGKLVRAVVGTIFDVAVDIRKSSPSFGQWVGYELSAENKRQLWVPPGFAHGFLVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPF 171
               EVIYK TD+Y+   D  + W D  + I WPL +   P +S KD Q  PF
Sbjct: 124 SEVAEVIYKTTDYYAPGGDRTILWNDPDLAINWPLKEP--PILSAKDSQGQPF 174


>gi|46015557|pdb|1RTV|A Chain A, Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase)
           Crystal Structure From Pseudomonas Aeruginosa, Apo
           Structure
 gi|112491446|pdb|2IXJ|A Chain A, Rmlc P Aeruginosa Native
 gi|118138550|pdb|2IXH|A Chain A, Rmlc P Aeruginosa With Dtdp-Rhamnose
 gi|118138551|pdb|2IXH|B Chain B, Rmlc P Aeruginosa With Dtdp-Rhamnose
          Length = 184

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E     V FVQDNHS S   G +RGLH+Q
Sbjct: 9   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 67

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 68  -IRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 126

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+ 
Sbjct: 127 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQ 173


>gi|114563991|ref|YP_751505.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella frigidimarina
           NCIMB 400]
 gi|114335284|gb|ABI72666.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella frigidimarina
           NCIMB 400]
          Length = 182

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 107/167 (64%), Gaps = 6/167 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           I  V+I++   F D RG+F +T+S +  +EL  G    FVQDNHS S   G +RGLH+Q 
Sbjct: 8   IADVKIIEPAVFGDERGFFMETWSQQKFEELVTGKPTKFVQDNHSKS-KKGILRGLHYQT 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR ++G +FD+AVDIR+ SPT+G WV + +SA N  Q+++P GFAHGF    
Sbjct: 67  KN-TQGKLVRVVSGEVFDVAVDIRKGSPTFGQWVGVYLSAENKRQLWVPEGFAHGFYVTS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
              E +YK TD+Y+ + +  +AW D  I I WP+ +T  P +SEKD+
Sbjct: 126 EEAEFVYKCTDYYNPKAELSIAWNDSDIGIKWPISNT--PLLSEKDK 170


>gi|330505516|ref|YP_004382385.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas mendocina NK-01]
 gi|328919802|gb|AEB60633.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas mendocina NK-01]
          Length = 182

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 107/164 (65%), Gaps = 4/164 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++   E  G+   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPQVFGDERGFFYESFNARRFAEATGVTRDFVQDNHSRSAR-GVLRGLHYQLQQ-A 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG ++D+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L    E
Sbjct: 69  QGKLVRVSAGEVYDVAVDVRRSSPNFGKWVGVHLSAENKRQLWVPEGFAHGFLVLSEYAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            +YK TD+Y+  H+  + W D+ + I WP L+ + P +S KDQ 
Sbjct: 129 FLYKTTDYYAPAHERCIRWDDQQLAIDWP-LEGLTPQLSAKDQQ 171


>gi|325922242|ref|ZP_08184027.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthomonas gardneri ATCC
           19865]
 gi|325547276|gb|EGD18345.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xanthomonas gardneri ATCC
           19865]
          Length = 193

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 105/167 (62%), Gaps = 3/167 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++  +  D+RGWF++ + ++ + + GL D FVQ N+SF+   GT+RG+H+Q PP A+ K
Sbjct: 13  VIEPEQRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAQAGTLRGMHYQLPPAAEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           +VRCI G ++D  VD+R +S TY  W   E++A N L +Y+P GFAHGF+TL+  TE  Y
Sbjct: 73  IVRCIRGALWDAIVDLRPDSRTYLQWYGTELTAENRLALYVPRGFAHGFITLQPQTEAFY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
                Y+ + + G+ W D  + + WPL   +   VS+KD   P  N+
Sbjct: 133 FANAMYTPQAERGLRWNDPRLGLQWPLEPQL---VSDKDAAWPDFNE 176


>gi|297569781|ref|YP_003691125.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925696|gb|ADH86506.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 346

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (65%), Gaps = 4/141 (2%)

Query: 34  GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCW 93
           GL+  FVQDNHS S   G +RGLH+Q PP AQ KLVR + G +FD+AVDIR NSPT+G W
Sbjct: 205 GLRPNFVQDNHSKS-QKGVLRGLHYQLPPKAQGKLVRVVQGEVFDVAVDIRHNSPTFGRW 263

Query: 94  VSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP 153
           V   +SA+N  Q++IP GFAHG +TL    E +YK TDFY+ EH+  +AW D  I I W 
Sbjct: 264 VGQRLSADNKRQLWIPEGFAHGVLTLTPTAEFLYKTTDFYAPEHERCIAWNDPDIGIDWG 323

Query: 154 LLDTILPSVSEKDQN-LPFLN 173
             D   P +S KD+  +P  N
Sbjct: 324 YEDA--PLLSAKDRECVPLRN 342


>gi|313201256|ref|YP_004039914.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylovorus sp. MP688]
 gi|312440572|gb|ADQ84678.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylovorus sp. MP688]
          Length = 181

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 112/170 (65%), Gaps = 8/170 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPY 63
           V I + + F D+RG+F ++Y+    + L GL+  FVQDNHS S   G +RGLH+Q R P 
Sbjct: 11  VLIFEPKVFGDARGFFFESYNQNTFEALTGLKRTFVQDNHSASAK-GVLRGLHYQIRQP- 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR +AG + D+AVD+R+NSP++G W S  +SA N  Q+++P GFAHGF+ L    
Sbjct: 69  -QGKLVRVVAGEVLDVAVDMRKNSPSFGRWTSAILSAENRRQMWVPEGFAHGFVVLSEFA 127

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPFL 172
           E +YK TDFY+ EH+  + W D +++I W L  T  P++S KD + L FL
Sbjct: 128 EFLYKTTDFYAPEHECCIRWDDPTLNIDWQL--TAPPALSAKDSRGLDFL 175


>gi|255020605|ref|ZP_05292668.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidithiobacillus caldus ATCC
           51756]
 gi|254969990|gb|EET27489.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidithiobacillus caldus ATCC
           51756]
          Length = 182

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 109/177 (61%), Gaps = 4/177 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           + I  V ++  R F D+RG+F ++++ +     GL   FVQDNHS S   G +RGLH+Q 
Sbjct: 6   LAIPEVLLITPRVFGDARGFFLESWNRRSFAAAGLDLDFVQDNHSRS-QRGVLRGLHYQI 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           R P  Q KLVR +AG +FD+AVD+RR+SP +G WV   +SA+N   +++P GFAHGF+ L
Sbjct: 65  RQP--QGKLVRVVAGEVFDVAVDLRRSSPHFGRWVGARLSADNAQMLWVPPGFAHGFLVL 122

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               + +YK TD+Y  E +  + W D S+ + WPL     P+++ KD     L Q++
Sbjct: 123 SEQADFLYKTTDYYLPEAERCLRWDDPSVGVQWPLAPGSQPTLAAKDAAGSLLAQLE 179


>gi|15679778|ref|NP_276896.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|74548927|sp|O27818|RMLC_METTH RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|12084451|pdb|1EP0|A Chain A, High Resolution Crystal Structure Of
           Dtdp-6-Deoxy-D-Xylo-4- Hexulose 3,5-Epimerase From
           Methanobacterium Thermoautotrophicum
 gi|12084452|pdb|1EPZ|A Chain A, Crystal Structure Of Dtdp-6-Deoxy-D-Xylo-4-Hexuloase 3,5-
           Epimerase From Methanobacterium Thermoautotrophicum With
           Bound Ligand.
 gi|2622921|gb|AAB86256.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 185

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (63%), Gaps = 6/163 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++   + D RG+F +T++  + +E GL+  FVQDN S S   G +RGLHFQR    Q K
Sbjct: 16  IIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVR-GVLRGLHFQREK-PQGK 73

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR I G IFD+AVD+R+NS TYG W  + +S  N  + +IP GFAHGF+ L     V Y
Sbjct: 74  LVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNY 133

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQN 168
           K T+ Y  E+DSG+ W D  I I WPL  +D ++  +SEKD+N
Sbjct: 134 KCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLI--ISEKDRN 174


>gi|254243955|ref|ZP_04937277.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa 2192]
 gi|296392019|ref|ZP_06881494.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa PAb1]
 gi|126197333|gb|EAZ61396.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa 2192]
          Length = 181

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E     V FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 65  -IRQAQGKLVRATLGEVFDVAVDLRRGSPTFGHWVGERLSAENKRQMWIPAGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+ 
Sbjct: 124 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQ 170


>gi|320107280|ref|YP_004182870.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Terriglobus saanensis SP1PR4]
 gi|319925801|gb|ADV82876.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Terriglobus saanensis SP1PR4]
          Length = 199

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 107/179 (59%), Gaps = 8/179 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++     D RGWF++ ++++  +E GL   FVQDN S S   G +RGLH+Q     Q
Sbjct: 11  VKLIEPTLHRDGRGWFAEAFNARSFREQGLPSDFVQDNQSMS-QRGVLRGLHYQLG-QPQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEI---SANNGLQ-IYIPTGFAHGFMTLEM 121
            KLVRC++G I+D+AVD+RR SP +G W    +   ++   LQ ++IP GF HGF+ L  
Sbjct: 69  GKLVRCVSGHIWDVAVDLRRTSPDFGKWAGFHLRPLTSEGKLQMLWIPEGFGHGFLVLSE 128

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDSP 178
             E++YK T+ Y  + D  V W D  I I WPL  LD + P VS KD   PFLN  + P
Sbjct: 129 TAELLYKTTNHYFPQGDRAVRWNDPEIAIEWPLAELDGLEPIVSAKDTVAPFLNSAELP 187


>gi|15600357|ref|NP_253851.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa PAO1]
 gi|107104265|ref|ZP_01368183.1| hypothetical protein PaerPA_01005339 [Pseudomonas aeruginosa PACS2]
 gi|116053311|ref|YP_793635.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218894264|ref|YP_002443134.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa
           LESB58]
 gi|254238136|ref|ZP_04931459.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa C3719]
 gi|313110227|ref|ZP_07796123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa 39016]
 gi|81622016|sp|Q9HU21|RMLC_PSEAE RecName: Full=dTDP-4-dehydrorhamnose 3,5-epimerase; AltName:
           Full=Thymidine diphospho-4-keto-rhamnose 3,5-epimerase;
           AltName: Full=dTDP-4-keto-6-deoxyglucose 3,5-epimerase;
           AltName: Full=dTDP-6-deoxy-D-xylo-4-hexulose
           3,5-epimerase; AltName: Full=dTDP-L-rhamnose synthase
 gi|9951466|gb|AAG08549.1|AE004929_4 dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa PAO1]
 gi|27262962|emb|CAC82199.1| dTDP-4-keto-6-deoxy-D-glucose 3,5 epimerase [Pseudomonas
           aeruginosa]
 gi|115588532|gb|ABJ14547.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126170067|gb|EAZ55578.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa C3719]
 gi|218774493|emb|CAW30310.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa
           LESB58]
 gi|310882625|gb|EFQ41219.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa 39016]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E     V FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 65  -IRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+ 
Sbjct: 124 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQ 170


>gi|326318817|ref|YP_004236489.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375653|gb|ADX47922.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 113/183 (61%), Gaps = 12/183 (6%)

Query: 1   MNINPVRI-----LKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIR 54
           MN+ P RI     L+ + F D+RG+F ++++ +   E  G +  FVQDNHS S   G +R
Sbjct: 1   MNVLPTRIPDVVVLEPKVFGDARGFFFESFNQRAFDEATGSRHAFVQDNHSRS-ARGVLR 59

Query: 55  GLHFQ-RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFA 113
           GLH+Q R P  Q KLVR + G +FD+AVD+RR+SPT+G WV  E+S  N  Q+++P GFA
Sbjct: 60  GLHYQIRQP--QGKLVRVVRGTVFDVAVDLRRSSPTFGQWVGEELSEENQRQMWVPPGFA 117

Query: 114 HGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           HGF+ L  + + +YK TD+Y+ EH+  +AW D  I I W       PS+S KD     L 
Sbjct: 118 HGFVVLSESADFLYKTTDYYAPEHERCIAWNDPGIGIDWRFAGE--PSLSAKDAKGTSLR 175

Query: 174 QID 176
           + +
Sbjct: 176 EAE 178


>gi|112491444|pdb|2IXI|A Chain A, Rmlc P Aeruginosa With Dtdp-Xylose
 gi|112491445|pdb|2IXI|B Chain B, Rmlc P Aeruginosa With Dtdp-Xylose
 gi|114794832|pdb|2IXK|A Chain A, Rmlc P Aeruginosa With Dtdp-4-Keto Rhamnnose (The Product
           Of The Reaction)
 gi|114794833|pdb|2IXK|B Chain B, Rmlc P Aeruginosa With Dtdp-4-Keto Rhamnnose (The Product
           Of The Reaction)
          Length = 184

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E     V FVQDNHS S   G +RGLH+Q
Sbjct: 9   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 67

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 68  -IRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 126

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+ 
Sbjct: 127 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQ 173


>gi|306845701|ref|ZP_07478270.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO1]
 gi|306274022|gb|EFM55849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO1]
          Length = 174

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 107/172 (62%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NI+    ++  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNIDGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ + KLV C+ G ++D+ VDIR +SPTY  W  +E+SA NG Q+YIP G AHGF TL 
Sbjct: 66  EPHCETKLVTCLQGIVWDVLVDIRPHSPTYRRWAGVELSAENGAQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPDKPSV---ISQKDLGWPFL 174


>gi|120555539|ref|YP_959890.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Marinobacter aquaeolei VT8]
 gi|120325388|gb|ABM19703.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Marinobacter aquaeolei VT8]
          Length = 186

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 110/176 (62%), Gaps = 4/176 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +  V IL+ R F D RGWF ++++++   + +G    FVQDNHS S   G +RG+HFQ  
Sbjct: 8   LEGVLILEPRVFGDDRGWFYESFNAERFADAVGKPVAFVQDNHSRSAK-GVLRGIHFQTG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KLVR   G +FDIAVD+R++SPT+G W  + +SA N  Q+++P GF H F+    
Sbjct: 67  RAAQGKLVRATFGEVFDIAVDLRKSSPTFGQWTGVLLSAENKRQLWVPAGFGHAFLVTSD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             EV YKV  ++S EH+  + W D ++ + WP +  +   +SEKD++ P LN +++
Sbjct: 127 VAEVQYKVDAYWSAEHERSLRWDDPAVAVEWPEVGEV--QLSEKDRHAPDLNVLNA 180


>gi|150017459|ref|YP_001309713.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149903924|gb|ABR34757.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 191

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 106/174 (60%), Gaps = 2/174 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++ + F D+RG+F + Y+ K  +  G    FVQDN S S   G +RGLHFQR  
Sbjct: 11  IKGLYIIEPKVFGDNRGYFMENYNKKQFEAAGFNMNFVQDNESKSVK-GVLRGLHFQRE- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           ++Q KL+R   G +FD+AVD+R  S TYG W  + +S  N  Q Y+P GFAHGF+ +   
Sbjct: 69  HSQGKLIRVTKGEVFDVAVDLRNGSKTYGNWEGIVLSEENKKQFYVPEGFAHGFLVISNE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             + YK TD+Y+ E++ G+ W D  I++ WPL +     +SEKD+    L+++D
Sbjct: 129 AILNYKCTDYYAKEYECGIMWNDPDINVNWPLENIENVILSEKDKANSMLSELD 182


>gi|78213549|ref|YP_382328.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. CC9605]
 gi|78198008|gb|ABB35773.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. CC9605]
          Length = 193

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 101/162 (62%), Gaps = 4/162 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  + F D RGWF ++++ +   + +G   +F QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LITPQAFGDDRGWFYESWNQRKFDDAVGESVLFSQDNHSRSIQ-GVLRGLHYQLAPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G I+D+AVDIRRNSPT+G WV  E+SA N  Q++IP GFAHGF+TL    EV 
Sbjct: 78  KLVRATVGAIYDVAVDIRRNSPTFGAWVGAELSAENKCQLWIPEGFAHGFLTLSDVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKD 166
           YK   F++   + G+ W D  + I WP+  L     S+S KD
Sbjct: 138 YKARGFWNKSCERGIIWNDSDLAIAWPIDRLQGAEVSLSGKD 179


>gi|302669916|ref|YP_003829876.1| dTDP-4-dehydrorhamnose 3,5-epimerase RfbC2 [Butyrivibrio
           proteoclasticus B316]
 gi|302394389|gb|ADL33294.1| dTDP-4-dehydrorhamnose 3,5-epimerase RfbC2 [Butyrivibrio
           proteoclasticus B316]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 101/164 (61%), Gaps = 2/164 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  ++++  + F DSRG+F +TY+     E G+   FVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGLKVITPQVFGDSRGYFVETYNKNDFVEAGITCEFVQDNQSAS-KRGVLRGLHFQKE- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVRCI G +FD+AVD+RR+S T+G W  + +SA N  Q +IP GFAHGF+ L   
Sbjct: 69  FPQDKLVRCINGEVFDVAVDLRRDSKTFGKWFGVVLSAENKKQFFIPKGFAHGFLVLSDY 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            E  YK +DFY    + G+ W D  I + WPL D +    S+KD
Sbjct: 129 AEFAYKCSDFYHPNDEGGLIWNDPDIGVEWPLQDGVELIFSDKD 172


>gi|332995215|gb|AEF05270.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Alteromonas sp. SN2]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 109/167 (65%), Gaps = 2/167 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+I++ + F D RG+F +T+ +   K+      FVQDNHS S   G +RGLH+Q  
Sbjct: 7   DIPDVKIIEPKVFGDERGFFLETFRTDWFKKECADVEFVQDNHSKS-SQGILRGLHYQLE 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G ++D+AVD+R++SPTYG WV + +SA N  Q+++P GFAHGF     
Sbjct: 66  Q-TQGKLVRVVSGEVYDVAVDMRKDSPTYGKWVGVLLSAENKRQLWVPAGFAHGFYVTSE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           + E +YK TD+Y  E +  V + D +++I WPL++   PS+S KD+N
Sbjct: 125 SAEFVYKCTDYYHPESEVSVKFNDPTLNIDWPLVNGEKPSLSGKDEN 171


>gi|88808162|ref|ZP_01123673.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 7805]
 gi|88788201|gb|EAR19357.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 7805]
          Length = 195

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 103/173 (59%), Gaps = 4/173 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  R F D RGWF ++++ +   E  G   VF QDNHS S   G +RGLH+Q  P  Q 
Sbjct: 19  LISPRAFGDERGWFFESWNQRKFDEAAGETVVFSQDNHSRSVQ-GVLRGLHYQLAPEPQG 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G IFD+AVDIR+ S T+G WV   +SA N  Q+++P GFAHGF+TL    EV 
Sbjct: 78  KLVRASIGEIFDVAVDIRQGSATFGQWVGAHLSAENKQQLWVPEGFAHGFLTLSPVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLPFLNQIDS 177
           YK   F++ E +  + W D SI+I WPL  L     S+S KD +   L+Q  +
Sbjct: 138 YKARGFWNKECERAIVWNDASINIQWPLDQLGGAEVSLSGKDADAASLDQAKA 190


>gi|229587853|ref|YP_002869972.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas fluorescens
           SBW25]
 gi|229359719|emb|CAY46567.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas fluorescens
           SBW25]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 109/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I++ + F D RG+F ++Y+++   +   Q V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 11  VLIIEPKVFGDERGFFYESYNARNFAQATGQHVDFVQDNHSRS-QKGVLRGLHYQ-IEHA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG + D+AVDIRR+SP +G W S+ +SA N  Q++IP GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTAGEVLDVAVDIRRSSPHFGKWASVRLSAENSRQLWIPPGFAHGFVVLSDSAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  + W D  +DI W    T  P++S KDQN   L + D
Sbjct: 129 FLYKTTDYYTPSAERCIRWDDADLDIDWQFAGT--PTLSGKDQNGKSLKEAD 178


>gi|49081796|gb|AAT50298.1| PA5164 [synthetic construct]
          Length = 182

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E     V FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 65  -IRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+ 
Sbjct: 124 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQ 170


>gi|297569786|ref|YP_003691130.1| glucose-1-phosphate thymidylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925701|gb|ADH86511.1| glucose-1-phosphate thymidylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 401

 Score =  147 bits (372), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (65%), Gaps = 4/141 (2%)

Query: 34  GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCW 93
           GL+  FVQDNHS S   G +RGLH+Q PP AQ KLVR + G +FD+AVDIR NSPT+G W
Sbjct: 260 GLRPNFVQDNHSKS-QKGVLRGLHYQLPPKAQGKLVRVVQGEVFDVAVDIRHNSPTFGRW 318

Query: 94  VSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP 153
           V   +SA+N  Q++IP GFAHG +TL    E +YK TDFY+ EH+  +AW D  I I W 
Sbjct: 319 VGQRLSADNKRQLWIPEGFAHGVLTLTPTAEFLYKTTDFYAPEHERCIAWNDPDIGIDWG 378

Query: 154 LLDTILPSVSEKDQN-LPFLN 173
             D   P +S KD+  +P  N
Sbjct: 379 YEDP--PLLSTKDRECVPLCN 397


>gi|325970221|ref|YP_004246412.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta sp. Buddy]
 gi|324025459|gb|ADY12218.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta sp. Buddy]
          Length = 180

 Score =  147 bits (372), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 3/168 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V +++ R F D RG+F +TY+     + G+ + FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIEGVFVIEPRVFGDERGYFMETYNKADFHKAGINNEFVQDNQSKS-RKGVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y QAKLVR   G ++D+AVD+R++SPTYG +V + +SA    Q +IP GFAHGF+ L  
Sbjct: 69  -YPQAKLVRVTKGEVYDVAVDLRKDSPTYGKYVGVHLSAEKKNQFFIPRGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNL 169
             E  YK  +FY  E +  + W D  I I WP +  IL S+SEKD+ L
Sbjct: 128 EAEFTYKCDEFYHPEDEGSIRWDDPIIGIQWPEI-GILFSLSEKDKAL 174


>gi|298481186|ref|ZP_06999380.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
 gi|298272760|gb|EFI14327.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D22]
          Length = 189

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 114/181 (62%), Gaps = 4/181 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IESVVIIEPRLFKDDRGYFFESFSQREFTEKVRKVDFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  VS+E++  N  Q +IP GFAHGF+ L   
Sbjct: 67  YAQSKLVRVIKGSVLDVAVDIRKGSPTFGEHVSVELTERNHCQFFIPRGFAHGFVVLTEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK  +FY+ + +  +AW D ++ I W +  D I+  +SEKD++   L +    F+Y
Sbjct: 127 VIFQYKCDNFYAPQCEGALAWDDPALKIDWKVPADKII--LSEKDKHHERLEEASWLFDY 184

Query: 182 D 182
           +
Sbjct: 185 N 185


>gi|193213370|ref|YP_001999323.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobaculum parvum NCIB
           8327]
 gi|193086847|gb|ACF12123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobaculum parvum NCIB
           8327]
          Length = 185

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 107/175 (61%), Gaps = 3/175 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V + + + F D RGWF +++   + ++      FVQDN SFS   G +RGLH+Q+PPY Q
Sbjct: 11  VLVFEPQVFGDDRGWFFESFRQDMFEQHAGSHRFVQDNESFS-RHGVVRGLHYQKPPYTQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR   G + D+AVDIR+ SPT+G   +  +S NN   +++P GFAHGF  L  +   
Sbjct: 70  GKLVRASRGEVLDVAVDIRKGSPTFGQHTAQLLSENNRRMMWLPPGFAHGFAVLSDSAVF 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180
            YK T +Y+  HD+G+ W D +I I W L +  + S+S+KD   P L++I+ P E
Sbjct: 130 SYKCTGYYAPTHDAGIRWNDPAIGIDWRLSEQEI-SLSDKDLRQPLLHEIE-PLE 182


>gi|297171712|gb|ADI22705.1| dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
           [uncultured Rhodospirillales bacterium HF0500_23A22]
          Length = 204

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (60%), Gaps = 4/183 (2%)

Query: 4   NPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPP 62
            PV  +  R   D RG F++T+ +   ++  + DV  VQ+N S S    T+RGLH+Q  P
Sbjct: 12  GPVLFVPNRH-RDPRGIFAETFRADEFRD-AIGDVDLVQENQSISHPINTVRGLHYQAEP 69

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KL+R + G + D+AVDIR +SPT+G  + +E+SA N  Q++IP GFAHGF TL  +
Sbjct: 70  HAQGKLMRVVQGAVLDVAVDIRPHSPTFGRHIKIELSAENWYQLWIPPGFAHGFKTLRPD 129

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           T VIYKV+D+YS  HD G+AW D  + I W L       +S+KD+  P   ++   F   
Sbjct: 130 THVIYKVSDYYSPSHDHGMAWNDPDLGIDWELYGQQA-VLSDKDRQQPRFCEVTPLFAGG 188

Query: 183 GLP 185
            +P
Sbjct: 189 AIP 191


>gi|269102102|ref|ZP_06154799.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268162000|gb|EEZ40496.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 181

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 109/176 (61%), Gaps = 6/176 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKKFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR+NSPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVAVDIRKNSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               E +YK TDFY+ + +  + W D  I I WPL +   P +S+KD     L +I
Sbjct: 125 SDEAEFVYKCTDFYNPKAEHSILWNDLDIGIEWPLDNA--PVLSDKDSKGTLLTKI 178


>gi|331086187|ref|ZP_08335269.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406346|gb|EGG85860.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 183

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (60%), Gaps = 2/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ ++++    F D RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ   
Sbjct: 11  IDGLKVITPTVFGDERGYFMETYNYNDYKEAGIDMEFVQDNQSCS-KKGVLRGLHFQ-IN 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR ++G ++D+AVD+R  S TYG W  + +SA N  Q +IP  FAHGF+ L  +
Sbjct: 69  YPQDKLVRVVSGEVYDVAVDLREGSETYGKWYGVLLSAENKKQFFIPKNFAHGFLVLSES 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            E  YK TDFY    + G+AW D  I + WP+ + +  ++SEKDQ    + ++
Sbjct: 129 AEFAYKCTDFYHPNDEGGLAWNDPDIGVEWPIPEGMELTISEKDQKWTGIKEL 181


>gi|209883772|ref|YP_002287629.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oligotropha carboxidovorans
           OM5]
 gi|209871968|gb|ACI91764.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oligotropha carboxidovorans
           OM5]
          Length = 188

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 112/175 (64%), Gaps = 6/175 (3%)

Query: 2   NINPVR---ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHF 58
           N +P+R    ++  K  D RG+F++ +  +   + GL+  FVQ N+S +   GT+RGLH+
Sbjct: 4   NPSPLRGACTIELEKRGDDRGFFARMFCEREFADAGLETRFVQVNNSLTAKRGTLRGLHY 63

Query: 59  QRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
           Q PP A+ K+VRC+ G ++D+ VD+R +SPT+  W   E++A+N   +Y+P GFAH F+T
Sbjct: 64  QLPPAAEVKVVRCVRGALYDVIVDLRPDSPTFRKWFGAELTADNRTMMYVPRGFAHAFLT 123

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           L  + E +Y V+ FYS E++ GV + D +  I WP +D +   VS+KD+N P  N
Sbjct: 124 LTDDAEAMYLVSAFYSPENERGVRYNDPAFSIAWP-VDPL--EVSDKDRNWPDFN 175


>gi|148976929|ref|ZP_01813584.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrionales bacterium SWAT-3]
 gi|145963803|gb|EDK29063.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrionales bacterium SWAT-3]
          Length = 187

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 109/176 (61%), Gaps = 6/176 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           I  V+I++   F D RG+F +T+S K  +EL  G    FVQDNHS S   G +RGLH+Q 
Sbjct: 8   IPDVKIIEPTVFGDERGFFMETWSQKQFEELVTGKPTPFVQDNHSKS-KKGILRGLHYQT 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR ++G +FD+AVDIR+ SPT+G WV   +SA N  Q+++P GFAHGF    
Sbjct: 67  E-NTQGKLVRVVSGEVFDVAVDIRKGSPTFGQWVGEYLSAENKRQLWVPEGFAHGFYVTS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              E +YK TD+Y+   +  + W D++IDI WP     +P +S KD+    +N+I+
Sbjct: 126 EEAEFVYKCTDYYNPAAEETLMWDDETIDIKWPFQG--VPLLSGKDRKGTLINKIN 179


>gi|255036724|ref|YP_003087345.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dyadobacter fermentans DSM
           18053]
 gi|254949480|gb|ACT94180.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dyadobacter fermentans DSM
           18053]
          Length = 181

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 99/159 (62%), Gaps = 5/159 (3%)

Query: 12  RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRC 71
           R F D RG F ++++ +   +LGL   FVQDN SFS   G +RGLHFQ  P+AQ KLVR 
Sbjct: 17  RVFGDDRGMFFESFNEEAFTKLGLPVNFVQDNQSFS-KKGVVRGLHFQNAPFAQGKLVRV 75

Query: 72  IAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
           I GR+ D+AVDIR  SPT+G     E+S       YIP GFAHGF+ LE +T   YK T+
Sbjct: 76  ITGRVLDVAVDIRPGSPTFGKHEVFELSGEQNNIAYIPEGFAHGFVALE-DTIFSYKCTN 134

Query: 132 FYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            Y+ E +SG+ W D  ++I W + D   P VSEKD  LP
Sbjct: 135 LYNKESESGILWNDPDLNIDWGIAD---PIVSEKDLVLP 170


>gi|256820076|ref|YP_003141355.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga ochracea DSM
           7271]
 gi|256581659|gb|ACU92794.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga ochracea DSM
           7271]
          Length = 182

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 106/171 (61%), Gaps = 2/171 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++ + F D RG+F +++S +   EL    VFVQDN S S   G +RGLHFQ+P
Sbjct: 7   KIEGVVIIEPQVFFDGRGYFFESFSQQRFNELVSPTVFVQDNESQS-TYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVR + G + D+AVD+R++SPT+G + S+ ++  N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQAKLVRVVKGEVLDVAVDLRKDSPTFGQYESVILNEENKRQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
                YK  ++Y+ E +  V W D +I I W L   ++  +SEKD+  P L
Sbjct: 126 EAIFQYKCDNYYAPESEGSVRWDDPTIGIDWRLPAEVI-QLSEKDKKAPLL 175


>gi|255530275|ref|YP_003090647.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter heparinus DSM
           2366]
 gi|255343259|gb|ACU02585.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pedobacter heparinus DSM
           2366]
          Length = 184

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 99/145 (68%), Gaps = 1/145 (0%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ + ++D+RG+F ++Y++KL  E G+   FVQDN SFS   G +RG+H Q PP+ Q K
Sbjct: 13  VIEPKVWKDNRGYFYESYNAKLFAEAGISANFVQDNQSFS-QKGALRGMHAQSPPFEQGK 71

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + G ++DIAVDIR+ SPTYG    +E+S+ N  Q+++P GF HGF+TLE  T   Y
Sbjct: 72  LVRVLQGAVWDIAVDIRKASPTYGQHFGVELSSENHKQLWVPPGFLHGFLTLEDQTIFTY 131

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITW 152
           KV+++Y    + GV W D  ++I W
Sbjct: 132 KVSNYYDKASEIGVMWNDPDLNINW 156


>gi|163757897|ref|ZP_02164986.1| strX protein [Hoeflea phototrophica DFL-43]
 gi|162285399|gb|EDQ35681.1| strX protein [Hoeflea phototrophica DFL-43]
          Length = 182

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 106/175 (60%), Gaps = 9/175 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+P RI       D RG F++ + +      GL   + Q N S S   GT+RGLHFQRP
Sbjct: 13  RIDPERI------GDERGSFARMFCTSEFSAHGLATSWAQMNVSHSARVGTLRGLHFQRP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P A+AKLVRC+ G +FD+ VD+R  SP +G W S+E++  +G  +Y+P G AHGF TL  
Sbjct: 67  PAAEAKLVRCLKGAMFDVLVDLRSGSPGFGQWTSVELTPESGAMVYVPEGVAHGFQTLLP 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           +TEV+Y  +  Y  EH+ G+ + D+S+ + WPL  + L   SE+D+  P L  +D
Sbjct: 127 DTEVLYCHSVPYQREHEGGLRFDDESVGVAWPLPVSTL---SERDKAHPGLLALD 178


>gi|323152428|gb|EFZ38716.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Escherichia coli EPECa14]
          Length = 152

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 98/144 (68%), Gaps = 2/144 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V I + + F D RG+F ++++ K+ +E +G +  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKS-SKGVLRGLHYQLE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PYAQ KLVRC+ G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF+ L  
Sbjct: 67  PYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFLVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQD 145
             E +YK T++Y  E +  + W D
Sbjct: 127 IAEFVYKTTNYYHPESEGCIKWDD 150


>gi|313673123|ref|YP_004051234.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939879|gb|ADR19071.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 187

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 106/171 (61%), Gaps = 3/171 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  ++I++T  + D+RG F++ Y    L E+      VQ NHS +   GT+RGLHFQ PP
Sbjct: 12  IEGLKIVETASYIDTRGAFTRLYCECELAEIIGSRRIVQINHSCTQQVGTVRGLHFQYPP 71

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +A+ KLVRC+ GR++D+AVD+R NSPT+  W + E++  NG  I IP GFAHGF  LE  
Sbjct: 72  HAEMKLVRCLRGRVWDVAVDLRANSPTFLHWHAEELTPENGRMIIIPEGFAHGFQVLEAA 131

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           +E++Y  T +Y+   ++G  + D  + I WPL    +  +S +D N P L 
Sbjct: 132 SELLYLHTAYYAPSAEAGFRYDDPCLGIKWPL---PVSELSPRDANHPLLK 179


>gi|53712099|ref|YP_098091.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides fragilis YCH46]
 gi|52214964|dbj|BAD47557.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides fragilis YCH46]
          Length = 189

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ R F D RG F ++++  +  E   + +FVQDN S S   G IRGLHFQ+P
Sbjct: 7   DIKGVMIIEPRLFSDERGHFFESFNQNIFVEEVCKTMFVQDNESKS-SYGVIRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D+AVDIRRNSP +G +VS+E++ +N  Q++IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVVKGAVLDVAVDIRRNSPFFGKYVSVELTEDNHRQLFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  + Y+ + +  +AW D  + I W  P+   +L   SEKD     L   D  F
Sbjct: 126 EVVFQYKCDNLYAPQCEGAIAWNDPDLGIDWKIPMEKVVL---SEKDSCHSVLKDTDWLF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|72383078|ref|YP_292433.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002928|gb|AAZ58730.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prochlorococcus marinus str.
           NATL2A]
          Length = 196

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 111/169 (65%), Gaps = 7/169 (4%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQ-----DVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           F D RG F ++++S++  +L L       +F+QDN SFS   G +RGLH+Q  P+ Q KL
Sbjct: 25  FNDERGNFFESWNSQIFDDLLLNHDQGPQIFLQDNQSFSRK-GVLRGLHYQITPHVQGKL 83

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           VRCIAG I+D+ VD+R +S T+  W S+ +SA N  Q+++P GFAHGF++L   TEV+YK
Sbjct: 84  VRCIAGEIYDVIVDLRMSSKTFKSWGSINLSAQNKKQLWVPVGFAHGFLSLTDCTEVLYK 143

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
            TD++  + + G++W D  I I WP  + + P +S+KD  LP  +++ S
Sbjct: 144 TTDYWDPKCERGISWDDPDIKIIWP-ENFLHPELSKKDLMLPSFSELKS 191


>gi|224538134|ref|ZP_03678673.1| hypothetical protein BACCELL_03025 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520262|gb|EEF89367.1| hypothetical protein BACCELL_03025 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 193

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 115/184 (62%), Gaps = 4/184 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI+ + I++ +   DSRG+F ++++ K  +E   +  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   NIDQIAIIEPQIHSDSRGYFFESFNQKEFEEKVCKTTFVQDNESKS-SYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D+AVDIR  SPT+G  VS+E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVVKGAVLDVAVDIRIGSPTFGQHVSIELTEDNHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  + Y+ +++  +AW D  + I W +  D +L  +SEKD+  P L + +  F+
Sbjct: 126 EVIFQYKCDNLYAPQYEGAIAWDDPDLGIDWHIPKDKML--LSEKDKTHPRLKEAEWLFD 183

Query: 181 YDGL 184
           Y  +
Sbjct: 184 YSDM 187


>gi|149175092|ref|ZP_01853715.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Planctomyces maris DSM
           8797]
 gi|148846070|gb|EDL60410.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Planctomyces maris DSM
           8797]
          Length = 182

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 104/163 (63%), Gaps = 8/163 (4%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPPYAQ 65
           I+  R F D RG+F +T+  +  ++ G+   FVQDNHS S   G +RGLHFQ  RP   Q
Sbjct: 13  IITPRVFSDDRGFFKETFQQERYEQAGIPGPFVQDNHSRS-SAGILRGLHFQIHRP---Q 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           AKLV  + G I D+ VD+R+NSPT+G  +S+ +SA N  Q+++P GFAHGF  L    + 
Sbjct: 69  AKLVFAVEGEILDVCVDLRKNSPTFGKSISVLLSAENHKQLFVPAGFAHGFYVLSPRADF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           +YK TD+Y  EH+  + W D +++I WPL D   P +SEKD+ 
Sbjct: 129 MYKCTDYYFPEHERTLLWNDPALEIEWPLSDE--PILSEKDRK 169


>gi|330970569|gb|EGH70635.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 181

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F +++++K  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNAKAFQAATGLTREFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  N E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSENAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWDDAELAIDWQFDGQ--PNLSAKDQQGKRLKEAD 178


>gi|239813764|ref|YP_002942674.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Variovorax paradoxus S110]
 gi|239800341|gb|ACS17408.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Variovorax paradoxus S110]
          Length = 182

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 111/176 (63%), Gaps = 6/176 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ-R 60
           I  V +++ + F D+RG+F ++++ K   E +G    FVQDNHS S   G +RGLH+Q +
Sbjct: 8   IPEVLVIEPKVFGDARGFFYESFNGKAFDEAVGRHVEFVQDNHSRSAK-GVLRGLHYQIQ 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  Q KLVR + G +FD+AVDIR++SPT+G WV +E+S +N  Q+++P GFAHGF+ L 
Sbjct: 67  QP--QGKLVRVVRGAVFDVAVDIRKSSPTFGKWVGVELSEDNHRQLWVPEGFAHGFLVLS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              E +YK TD+Y+  H+  + W D  + I WP +    P +S KDQ    L Q +
Sbjct: 125 ETAEFLYKTTDYYAPAHERCIKWDDAKLGIAWPSVGA-HPQLSAKDQAGAALIQAE 179


>gi|261210463|ref|ZP_05924757.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio sp. RC341]
 gi|260840521|gb|EEX67087.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio sp. RC341]
          Length = 181

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 108/169 (63%), Gaps = 6/169 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T+S K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWSQKRFEELVTGKPTTFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G ++D+AVD+R  SPT+G W+ + +S+ N  Q+++P GFAHGF  L
Sbjct: 66  TEN-TQGKLVRVVSGEVYDVAVDVRAESPTFGQWIGVHLSSENKRQLWVPEGFAHGFYVL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TD+Y+   +  + W DK + I WP +DT  P +S+KDQN
Sbjct: 125 SEEAEFVYKCTDYYNPSAEVSIRWDDKELSIEWP-IDT-GPYLSDKDQN 171


>gi|21227268|ref|NP_633190.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosarcina mazei Go1]
 gi|20905616|gb|AAM30862.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosarcina mazei Go1]
          Length = 183

 Score =  147 bits (370), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 109/174 (62%), Gaps = 7/174 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  + IL+ + + D RG+F ++Y+ K L+ L G +  F+QDN S S   G IRGLH+Q  
Sbjct: 8   IKDLLILEAKVYADGRGYFFESYNKKTLESLTGKEYNFIQDNESRS-SYGVIRGLHYQLA 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY+QAKLVR + GR++D+AVD+R++SPT+G W  +E+S  N  Q  IP GFAHGF  L  
Sbjct: 67  PYSQAKLVRVLEGRVYDVAVDLRKDSPTFGKWEGVELSGENKKQFLIPKGFAHGFSVLSE 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
                YK  ++Y  E ++G+ + D +++I W  P  D  L   SEKD+ LP L 
Sbjct: 127 TAVFAYKCDEYYHPEAEAGIIYNDPALNIDWKIPERDAKL---SEKDKLLPELK 177


>gi|306840751|ref|ZP_07473499.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO2]
 gi|306289257|gb|EFM60504.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella sp. BO2]
          Length = 174

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 107/172 (62%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NI+    ++  + +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNIDGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQS 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+ + KLV C+ G ++D+ VD+R +SPTY  W  +E+SA NG Q+YIP G AHGF TL 
Sbjct: 66  EPHCETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGAQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  + Y ++  Y+ +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 126 DDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPDKPSV---ISQKDLGWPFL 174


>gi|94311664|ref|YP_584874.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cupriavidus metallidurans
           CH34]
 gi|93355516|gb|ABF09605.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Cupriavidus metallidurans CH34]
          Length = 184

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 111/167 (66%), Gaps = 6/167 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ-R 60
           I  V I++ + F D+RG+F ++++ K   E  GL   FVQDNHS S   G +RGLH+Q +
Sbjct: 10  IPDVMIIEPKVFGDARGFFFESFNQKAFGEATGLDLEFVQDNHSRS-AKGVLRGLHYQIQ 68

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  Q KLVR + GR+FD+AVDIR+ S T+G WV +E+S +N  Q ++P GFAHGF+ L 
Sbjct: 69  QP--QGKLVRVVRGRVFDVAVDIRKQSATFGKWVGVELSEDNHRQFWVPPGFAHGFVVLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            + + +YK TD+Y+ + +  +AW D  I I WP ++ ++P +S KDQ
Sbjct: 127 ESADFLYKTTDYYAPQFERTIAWNDPEIGIEWPQMN-VVPLLSAKDQ 172


>gi|325958659|ref|YP_004290125.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobacterium sp. AL-21]
 gi|325330091|gb|ADZ09153.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobacterium sp. AL-21]
          Length = 185

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 100/165 (60%), Gaps = 2/165 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I+ V I++   F D RG+F +TY     KE GL   FVQDN S S   G +RGLHFQ  
Sbjct: 10  SIDDVYIIEPTVFGDDRGYFMETYHQGEFKEAGLDMEFVQDNQSRSV-RGVLRGLHFQYT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G +FD+AVD+R NSPTYG + S+ +S  N  Q Y+P GFAHGF+ L  
Sbjct: 69  Q-PQGKLVRVIKGTVFDVAVDLRENSPTYGQYESVVLSEENKKQFYVPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             E  YK T FY+ + + G+ W D  I+I WPL +     +S+KD
Sbjct: 128 VAEFTYKCTAFYNADDEGGIMWNDPDINIEWPLKEAGNVVLSDKD 172


>gi|299137000|ref|ZP_07030183.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX8]
 gi|298601515|gb|EFI57670.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX8]
          Length = 192

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 105/176 (59%), Gaps = 2/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++++ +K  D RGWFS+ +++K     GL D FVQDN SFS   G +RGLH+Q     Q
Sbjct: 16  VKLVRPKKHGDERGWFSEVFNAKSFSAAGLPDRFVQDNQSFS-RRGVLRGLHYQLGE-QQ 73

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR ++G I+D+AVD+R NSP +G W   ++       ++IP GF HGF+ L     V
Sbjct: 74  GKLVRALSGHIWDVAVDLRPNSPDFGKWAGFDLKGEEIEFLWIPEGFGHGFVVLSETANV 133

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YK T+FY    +  V W D +++ITWPL    +PSVS KD     L + + P  Y
Sbjct: 134 LYKTTNFYYPAGERCVRWDDPTLNITWPLDGIGVPSVSAKDAIGNLLAEAELPPPY 189


>gi|309274612|gb|ADO64236.1| RmlC [Vibrio vulnificus]
          Length = 181

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 107/167 (64%), Gaps = 6/167 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           NI  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   NIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAHGF   
Sbjct: 66  TEN-TQGKLVRVVSGEVFDVAVDIRKDSPTFGQWVGEYLSAENKRQLWIPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E +YK TD+Y+ + +  + W D+++ I WPL +  +P +S KD
Sbjct: 125 SNEAEFVYKCTDYYNPDSEVSIKWDDETLKIQWPLAN--MPILSNKD 169


>gi|330998420|ref|ZP_08322244.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paraprevotella xylaniphila
           YIT 11841]
 gi|329568526|gb|EGG50331.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paraprevotella xylaniphila
           YIT 11841]
          Length = 190

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 110/180 (61%), Gaps = 4/180 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F D+RG+F +++S +    L     FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVVIIEPRLFNDARGYFFESFSQRDFDRLVRTVHFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGQHVAVELTEENHRQFFIPRGFAHGFSVLTPE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK  +FY+ + +  +AW D  + I W +  D IL  +SEKD+  P L   +  F+Y
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDPDLGINWHIPSDKIL--LSEKDKRHPRLKDAEWLFDY 184


>gi|21673145|ref|NP_661210.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium tepidum TLS]
 gi|21646222|gb|AAM71552.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium tepidum TLS]
          Length = 185

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 108/176 (61%), Gaps = 2/176 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V + +   F D RGWF +++   + ++      FVQDN SFS   G +RGLH+Q+P
Sbjct: 7   SIPDVLLFEPEVFGDERGWFCESFRQDIFEQHAGCHRFVQDNESFS-RYGVVRGLHYQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ Q KLVR I G + D+AVDIR+ SPT+G   +  ++ +N   ++IP GFAHGF  L  
Sbjct: 66  PHVQGKLVRVIRGEVLDVAVDIRKGSPTFGHHTAQLLNESNRRMMWIPPGFAHGFAVLSQ 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
                YK TD+Y+  HD+G+ W D +I I W + ++ +  +S+KD + P L++I+ 
Sbjct: 126 TAVFSYKCTDYYAPSHDAGIRWNDPAIGIEWSVPESEI-RLSDKDLHHPMLHEIEG 180


>gi|288559367|ref|YP_003422853.1| dTDP-4-dehydrorhamnose 3,5- epimerase RfbC1 [Methanobrevibacter
           ruminantium M1]
 gi|288542077|gb|ADC45961.1| dTDP-4-dehydrorhamnose 3,5- epimerase RfbC1 [Methanobrevibacter
           ruminantium M1]
          Length = 192

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 100/170 (58%), Gaps = 4/170 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V  ++   FED RG+F +TY+    K  G+   FVQDN S S   G +RGLHFQ  
Sbjct: 10  EIEGVFTVEPTVFEDERGYFMETYNENDFKAEGIDLTFVQDNQSKS-SKGVLRGLHFQYT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G +FD+ VD+R++SPTYG W+   +S  N  Q++IP GFAHGF+ L  
Sbjct: 69  Q-PQGKLVRVIKGEVFDVGVDLRKDSPTYGKWMGEILSEENKKQLFIPKGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS--VSEKDQNL 169
             E +YK TDFY  + + G+ W D  I I WPL D       +SEKD+ L
Sbjct: 128 EAEFVYKCTDFYKGDDEGGIQWNDPDIGIEWPLGDLKEEDLILSEKDKLL 177


>gi|227819574|ref|YP_002823545.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium fredii NGR234]
 gi|227338573|gb|ACP22792.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sinorhizobium fredii NGR234]
          Length = 179

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 99/162 (61%), Gaps = 3/162 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG F++ +  K + + GL   FVQ + S S   GT+RGLHFQ  P+ + KLV C  G 
Sbjct: 21  DDRGSFTRVFCEKEMADFGLATRFVQHSRSHSVRKGTLRGLHFQEEPHTEVKLVSCACGA 80

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           IFD+ VD+R NSPT   W+  E++  N  Q+YIP GFAHGF TL  + EV Y ++ FY+ 
Sbjct: 81  IFDVVVDLRPNSPTRNRWLGFELTPENMKQVYIPAGFAHGFQTLTEDAEVSYLISQFYTP 140

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
              +GV + D +  I WPL+ T   ++SE+D+  P + ++ S
Sbjct: 141 HAATGVRFNDPAFSINWPLMPT---AMSERDRTWPLVRKLVS 179


>gi|118595004|ref|ZP_01552351.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylophilales bacterium
           HTCC2181]
 gi|118440782|gb|EAV47409.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylophilales bacterium
           HTCC2181]
          Length = 182

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 105/165 (63%), Gaps = 2/165 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQD-VFVQDNHSFSFDCGTIRGLHFQ 59
           ++I  V+IL  + F+D RG F +T++ K   E   +D +FVQDN S S   G +RGLH+Q
Sbjct: 6   LSIPEVKILDPKIFKDERGLFYETFNQKNFNEFVDEDAIFVQDNISQSI-SGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P+ Q KLV  + G +FD+AVDIRR+S T+G +VS  +SA N  QI+IP GFAHGF+TL
Sbjct: 65  KSPFPQGKLVSVLQGEVFDVAVDIRRSSSTFGRYVSATLSAENKKQIWIPEGFAHGFLTL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
                V YK T+FYS   +  +AW D  ++I WP  D +  S  +
Sbjct: 125 SDTALVYYKATNFYSPIDERCIAWNDSVLNINWPNKDRLFFSAKD 169


>gi|152987706|ref|YP_001351220.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa PA7]
 gi|150962864|gb|ABR84889.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas aeruginosa PA7]
          Length = 181

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 107/177 (60%), Gaps = 5/177 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRS-ARGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 65  -IQQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               E +YK TDF++ E++  + W D  + I WPL +   P +SEKD+      + D
Sbjct: 124 SEYAEFLYKTTDFWAPEYERSIVWNDPDLKIDWPLREA--PLLSEKDRQAKAFAEAD 178


>gi|262192433|ref|ZP_06050585.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae CT 5369-93]
 gi|262031697|gb|EEY50283.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae CT 5369-93]
          Length = 178

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 111/176 (63%), Gaps = 6/176 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G   +FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTLFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  -TENTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               E +YK TD+Y+ + +  + W D+ + I WP+  +  P +SEKD     L +I
Sbjct: 125 SEEAEFVYKCTDYYNPKAEVSIRWNDEKLAIEWPI--STKPQLSEKDTQALQLAKI 178


>gi|218438466|ref|YP_002376795.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 7424]
 gi|218171194|gb|ACK69927.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. PCC 7424]
          Length = 180

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 108/177 (61%), Gaps = 7/177 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ- 59
            I  V I++ + F D RG+F ++++ K+ K+    D  FVQDNHS S     +RGLH+Q 
Sbjct: 7   EIPDVLIIEPKVFGDDRGFFYESFTEKVFKDKTEVDTHFVQDNHSRSLK-NVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR + G +FD+AVDIR NSPT+G WV   +SA N  Q+++P GFAHGF+ L
Sbjct: 66  KQP--QGKLVRVVLGEVFDVAVDIRSNSPTFGQWVGCRLSAENKRQLWVPEGFAHGFLVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
               E +YK TD+Y+ E++  + W D  I I WP+ D   P +S KDQ      + D
Sbjct: 124 SEAAEFLYKTTDYYAPEYERTIIWNDPDIGIDWPIEDE--PILSNKDQAGKLFKEAD 178


>gi|50982342|gb|AAT91795.1| putative dTDP-L-rhamnose processing protein [Yersinia
           enterocolitica]
          Length = 182

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (63%), Gaps = 6/169 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           NI  V+I++   F D RG+F + +  +  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   NIPDVKIIEPTVFGDDRGFFMEIWQKQKFEELVTGYPCDFVQDNHSKS-SKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR I+G ++D+AVDIRR+S T+G WV + +SA N  Q++IP GFAHGF   
Sbjct: 66  SVN-TQGKLVRVISGEVYDVAVDIRRDSETFGQWVGIYLSAENRRQLWIPKGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TD+Y+   +  ++W D S+DI WPL+D   P +S+KDQN
Sbjct: 125 SPVAEFVYKCTDYYNPAFEYSISWNDPSLDINWPLIDP--PILSDKDQN 171


>gi|170755117|ref|YP_001782316.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum B1 str.
           Okra]
 gi|169120329|gb|ACA44165.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium botulinum B1 str.
           Okra]
          Length = 189

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (58%), Gaps = 4/174 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + +++ + F D RG+F +T++ +  K  GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEDLYVIEPKVFSDPRGYFMETHNYEDFKTAGLDMVFVQDNQSKS-KKGVLRGLHFQKK- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G +FD+AVDIR NS T+G W  + +S  N  Q YIP GFAHGF+ L   
Sbjct: 69  HPQGKLVRVIKGEVFDVAVDIRENSSTFGKWYGVILSEENKKQFYIPGGFAHGFLVLSDE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSV--SEKDQNLPFLNQ 174
            E  YK TDFY  E + G+ W D +I I WP       ++  SEKD+    L  
Sbjct: 129 AEFYYKCTDFYHPEDEGGIIWNDPTISIVWPFEKIKDANILLSEKDRKWTILEH 182


>gi|300728483|ref|ZP_07061842.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella bryantii B14]
 gi|299774201|gb|EFI70834.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella bryantii B14]
          Length = 190

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 113/182 (62%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI+ V I++ R F D RG+F ++++ K   E      FVQDN S S   G +RGLHFQ+ 
Sbjct: 7   NIDGVVIIEPRIFADERGYFYESWNEKEFNEKVRPIRFVQDNQSKS-SYGVLRGLHFQKG 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            ++Q+KLVR + GR+ D+AVDIR+ SPT+G  V++E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  EHSQSKLVRVVKGRVLDVAVDIRKGSPTFGQHVAVELTEDNQRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  + Y  E +  +AW D+++ I W +  D ++  +SEKD N P L   DSP+ 
Sbjct: 126 TAIFQYKCDNLYCKESEGAIAWDDEALGIDWKIPADQVI--LSEKDANHPLLK--DSPYL 181

Query: 181 YD 182
           +D
Sbjct: 182 FD 183


>gi|256375866|ref|YP_003099526.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Actinosynnema mirum DSM
           43827]
 gi|255920169|gb|ACU35680.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Actinosynnema mirum DSM
           43827]
          Length = 200

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 104/171 (60%), Gaps = 4/171 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ VR+++   FED RG+F ++YS +  ++ GL   FVQDNHS S   G +RGLHFQ  
Sbjct: 19  EIDGVRVVQPEWFEDERGFFFESYSKRRWEQHGLHLDFVQDNHSRS-SRGVLRGLHFQTG 77

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q +LVRC  G I+D+ VDIR  SPT+G W  +E+SA N  Q+ +  GFAHGF  L  
Sbjct: 78  LAPQHRLVRCTVGAIWDVVVDIRVGSPTFGKWFGIELSATNRTQLLMGPGFAHGFAVLSD 137

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
             EV YK T F++ E +  +AW D  + I WP+ D   P++S KD   P L
Sbjct: 138 VAEVQYKTTGFHTPEAEGLLAWDDPDVGIPWPIED---PTLSAKDSANPSL 185


>gi|319789558|ref|YP_004151191.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermovibrio ammonificans
           HB-1]
 gi|317114060|gb|ADU96550.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermovibrio ammonificans
           HB-1]
          Length = 187

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 107/175 (61%), Gaps = 6/175 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++++R F+D RG+F + +     +  G++  FVQDN S S     +RGLH+Q  P AQ K
Sbjct: 15  LVESRLFKDGRGFFMELFKLPDFEAAGIKGPFVQDNLSLS-RKNVLRGLHYQVEPAAQGK 73

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV C+ G++FD+AVD+R+ SPT+G W   E+    G  +YIP GFAHGF+TL     V Y
Sbjct: 74  LVTCLRGKVFDVAVDLRKGSPTFGRWFGTELFP--GKMLYIPEGFAHGFLTLSEEALVFY 131

Query: 128 KVTDF-YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           KVT   YS EHD  + W D  I I WPL     P +SEKD+N P L++ +  F +
Sbjct: 132 KVTGSPYSPEHDRSLKWNDPQIGIEWPLDGE--PILSEKDRNAPSLSEAEINFRW 184


>gi|300865163|ref|ZP_07109987.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillatoria sp. PCC 6506]
 gi|300336853|emb|CBN55137.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillatoria sp. PCC 6506]
          Length = 184

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 108/184 (58%), Gaps = 9/184 (4%)

Query: 1   MNINPVRILKTRKF-----EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M I P+++  T +      +D RG+F + Y   + ++ GL   ++Q+N SFS   G IRG
Sbjct: 4   MEIKPLKLQGTYQITLAPRKDDRGYFMRAYDEAIFRDHGLTTAWLQENQSFS-KKGVIRG 62

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQ+PP+A+ KLVR ++G+I D+ VD+R+NS TYG W S+E+S  N    YIP GFAHG
Sbjct: 63  LHFQKPPHAETKLVRVVSGKILDVFVDLRKNSNTYGQWDSIELSEENHKIAYIPKGFAHG 122

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F +L     V+YKV + Y  E +  + W D+++ I W +     P  S KD      N  
Sbjct: 123 FCSLTETALVLYKVDEIYYPESEGNLRWNDETLAIKWTI---DRPLTSSKDAQGESFNDF 179

Query: 176 DSPF 179
            SPF
Sbjct: 180 ISPF 183


>gi|330954841|gb|EGH55101.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae Cit 7]
          Length = 181

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F +++++K  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNAKAFQAATGLTREFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDADLAIDWQFDGQ--PSLSAKDQQGKRLKEAD 178


>gi|218708291|ref|YP_002415912.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio splendidus LGP32]
 gi|218321310|emb|CAV17260.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio splendidus LGP32]
          Length = 182

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 110/167 (65%), Gaps = 4/167 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I+ V+I++   F D RG+F +T+ + + +K+ G +  FVQDNHS S   G +RGLHFQ+ 
Sbjct: 8   ISDVKIVEVSVFGDERGFFMETFRADEFMKQTGAKP-FVQDNHSKS-TKGILRGLHFQQG 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR  +G ++D+AVD+R++SPT+G  V +E+SA N  Q+++P GFAHGF  +  
Sbjct: 66  Q-TQGKLVRVTSGAVYDVAVDMRQSSPTFGKAVGVELSAENKRQLWVPEGFAHGFYVITD 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           + E +YK TD+Y  E +  V W D  + I WPL+D  LP +S KD +
Sbjct: 125 SAEFVYKCTDYYHPESEVSVRWDDVELAIEWPLVDGELPQLSAKDAD 171


>gi|303257171|ref|ZP_07343185.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderiales bacterium
           1_1_47]
 gi|331000814|ref|ZP_08324460.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parasutterella
           excrementihominis YIT 11859]
 gi|302860662|gb|EFL83739.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderiales bacterium
           1_1_47]
 gi|329570342|gb|EGG52075.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parasutterella
           excrementihominis YIT 11859]
          Length = 185

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 102/164 (62%), Gaps = 3/164 (1%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           ++ + F D RG+F +T+  K  +E G+   FVQDN SFS   GT+RGLHFQ+  + Q KL
Sbjct: 14  IQPKVFGDKRGFFLETWQKKRYEEAGIHYQFVQDNRSFS-SRGTLRGLHFQKR-FPQGKL 71

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           V  I G +FD+AVD+RR S TYG W  L +SA    Q++IP GFAHGF  L       YK
Sbjct: 72  VSVIFGEVFDVAVDLRRGSNTYGNWFGLVLSAEKCNQLWIPPGFAHGFYVLSETAFFEYK 131

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
            TD+Y  E ++G+ W DK I + WP+       +SEKD+N LPF
Sbjct: 132 CTDYYHPEDEAGILWNDKDIGVDWPIPPASTVLLSEKDRNGLPF 175


>gi|119947064|ref|YP_944744.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychromonas ingrahamii 37]
 gi|119865668|gb|ABM05145.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychromonas ingrahamii 37]
          Length = 185

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 109/176 (61%), Gaps = 5/176 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE--LGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
            I  V+I++   F D RG+F +T++ KL ++   G   +FVQDNHS S   G +RGLH+Q
Sbjct: 7   KIPDVKIIEPAVFGDERGFFMETWNQKLFEKEVTGKPTLFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR I+G +FD+AVDIR++S T+G WV + +S  N  Q+++P GFAHGF+  
Sbjct: 66  TE-NTQGKLVRVISGEVFDVAVDIRKSSATFGQWVGVTLSEENKRQLWVPEGFAHGFLVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               E +YK TD+Y+   +  + W D  I I WP+ + + P +SEKD+N   L  I
Sbjct: 125 SDEAEFVYKCTDYYNPTSEVSILWNDPDIGIEWPIKEEV-PLLSEKDKNAKLLKMI 179


>gi|254788158|ref|YP_003075587.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Teredinibacter turnerae
           T7901]
 gi|237683821|gb|ACR11085.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Teredinibacter turnerae
           T7901]
          Length = 182

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 107/166 (64%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F D RG+F +T+ +    E   +  FVQDNHS S   G +RGLH+Q   
Sbjct: 8   IPDVVIIEPRVFGDERGFFMETFRADAFAEHCTERPFVQDNHSASRQ-GILRGLHYQMEQ 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR ++G++FD+AVD+R++S T+G WV +E+SA+N  Q+++P GFAHGF  +   
Sbjct: 67  -TQGKLVRVVSGKVFDVAVDLRQSSATFGQWVGVELSADNKRQLWVPEGFAHGFYVMSEF 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E +YK TD+Y  + +  + W D ++ + WPL++   P++S KD +
Sbjct: 126 AEFVYKCTDYYHPQSERSLRWDDPTVGVEWPLVNGEAPALSAKDAD 171


>gi|327478701|gb|AEA82011.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas stutzeri DSM
           4166]
          Length = 181

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 109/168 (64%), Gaps = 7/168 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +I  V I++ + F D RG+F +++++   +   GL+  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   SIPDVLIIEPKVFGDERGFFYESFNAAAFEAATGLKRQFVQDNHSKS-QRGVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR +AG +FD+AVD+R++SP++G W    +SA N  Q++IP GFAHGF+ L
Sbjct: 66  QQP--QGKLVRVVAGEVFDVAVDLRKSSPSFGRWFGTHLSAQNQRQLWIPEGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
             + E +YK TD+Y+ EH+  + W D  + I WP  +   P +S KDQ
Sbjct: 124 SESAEFLYKTTDYYAPEHERSLLWNDPELGIQWPFDEA--PQLSAKDQ 169


>gi|288560318|ref|YP_003423804.1| dTDP-4-dehydrorhamnose 3,5-epimerase RfbC2 [Methanobrevibacter
           ruminantium M1]
 gi|288543028|gb|ADC46912.1| dTDP-4-dehydrorhamnose 3,5-epimerase RfbC2 [Methanobrevibacter
           ruminantium M1]
          Length = 187

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (60%), Gaps = 4/156 (2%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           FED RG+F +TY+    K  G+   FVQDN S S   G +RGLHFQ     Q KLVR I 
Sbjct: 22  FEDERGYFMETYNENDFKAEGIDLTFVQDNQSKS-SKGVLRGLHFQYTQ-PQGKLVRVIK 79

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G +FD+ VD+R++SPTYG WV   +S  N  Q++IP GFAHGF+ L    E +YK TDFY
Sbjct: 80  GEVFDVGVDLRKDSPTYGKWVGEILSEENKKQLFIPKGFAHGFLVLSDEAEFVYKCTDFY 139

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPSV--SEKDQ 167
             + + G+ W D  I I WPL +     +  SEKD+
Sbjct: 140 KGDDEGGIQWNDPEIGIKWPLGNLKEEDIILSEKDK 175


>gi|229008635|ref|ZP_04166047.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus mycoides Rock1-4]
 gi|228752640|gb|EEM02256.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus mycoides Rock1-4]
          Length = 155

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 97/153 (63%), Gaps = 3/153 (1%)

Query: 29  LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSP 88
           +L+ LG+   FVQDN S+S + G IRGLHFQ  P AQ KLV+ I G IFD+ VD+R+ SP
Sbjct: 1   MLRHLGIHHKFVQDNTSYSKEAGVIRGLHFQLEPRAQTKLVQVIQGAIFDVIVDLRKGSP 60

Query: 89  TYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSI 148
           TY  W S  ++ +N   + +P GFAHGF TL  +T V YKV +FY    DSG+AW D+  
Sbjct: 61  TYKKWQSFLLTGDNHRLLLVPKGFAHGFCTLVPHTIVHYKVDEFYDASCDSGIAWDDEEF 120

Query: 149 DITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            I+WP+ + IL   SEKD  LP   +    F++
Sbjct: 121 AISWPVSNPIL---SEKDGMLPKFTETTHYFQF 150


>gi|167461276|ref|ZP_02326365.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 179

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 104/163 (63%), Gaps = 3/163 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++   K ED RG+F++T+ +   +  GL   F+Q N S++   GTIRG+H+Q PPY +AK
Sbjct: 13  LIGLEKHEDERGFFTRTFCANEFEARGLMPQFIQCNLSYNRKRGTIRGMHYQHPPYGEAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV+CI G ++D+ +D+R  S TY    ++ ++ N+G  +YIP GFAHGF TL+  TEV+Y
Sbjct: 73  LVQCIRGELYDVIIDLRPLSKTYRQTFAVHLAGNSGTMLYIPEGFAHGFQTLQDETEVLY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            ++  Y  E  +G+ W D S  I WPL   I   +SE+D++ P
Sbjct: 133 YMSSPYKPEAAAGIRWNDPSFSIVWPLDVKI---ISERDRHYP 172


>gi|262275864|ref|ZP_06053673.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Grimontia hollisae CIP
           101886]
 gi|262219672|gb|EEY70988.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Grimontia hollisae CIP
           101886]
          Length = 182

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 104/166 (62%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  V++++   F D RG+F +TY + L  +   + VFVQ+NHS S   G +RGLH+Q  
Sbjct: 7   NIPDVKLIEPTVFGDERGFFMETYRTALFNDHCGERVFVQENHSKS-KKGILRGLHYQTE 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G +FD+A+D+R+ SP +G WV   +SA N  Q+++P GFAHGF     
Sbjct: 66  N-TQGKLVRVVSGEVFDVAIDMRKRSPYFGQWVGAYLSAENKRQLWVPEGFAHGFYVTSE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
             E +YK TD+Y+ + +  + W D ++ I WP+ D   PS+S KD+
Sbjct: 125 EAEFVYKCTDYYNPDVEVSIKWNDAALGIDWPIADAGPPSLSAKDE 170


>gi|237714662|ref|ZP_04545143.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D1]
 gi|262406527|ref|ZP_06083076.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_22]
 gi|294806945|ref|ZP_06765768.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|229445431|gb|EEO51222.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D1]
 gi|262355230|gb|EEZ04321.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_22]
 gi|294445832|gb|EFG14476.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides xylanisolvens SD
           CC 1b]
          Length = 189

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 114/181 (62%), Gaps = 4/181 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVVIIEPRLFKDDRGYFFESFSQREFTEKVRKVDFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF+ L   
Sbjct: 67  YAQSKLVRVIKGSVLDVAVDIRKGSPTFGEHVAVELTEENHRQFFIPRGFAHGFVVLTEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK  +FY+ + +  +AW D ++ I W +  D I+  +SEKD++   L +    F+Y
Sbjct: 127 VIFQYKCDNFYAPQCEGALAWDDPALKIDWKVPADKII--LSEKDKHHERLEEASWLFDY 184

Query: 182 D 182
           +
Sbjct: 185 N 185


>gi|297181613|gb|ADI17797.1| dtdP-4-dehydrorhamnose 3,5-epimerase and related enzymes
           [uncultured Sphingobacteriales bacterium HF0130_33B19]
          Length = 182

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 111/179 (62%), Gaps = 4/179 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  + I+K + F D RG F ++++ K  +++GL   F QDN S S   G +RGLHFQ 
Sbjct: 6   LSIEGLLIIKPKVFGDERGHFFESWNKKAYQDIGLDLDFTQDNQSIS-QKGVLRGLHFQN 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PPYAQ KLVR I G + D+AVD+R+ S TYG  +S++++  N    +IP GFAHGF+ LE
Sbjct: 65  PPYAQGKLVRVIKGAVIDVAVDLRKGSLTYGQHISVKLTEQNMKTFWIPPGFAHGFVALE 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            +T   YK T+ Y+ + +  + W D  ++I+W + +   P VSEKD++        SPF
Sbjct: 125 NDTIFSYKCTEVYNQDAEGSLLWNDPDLNISWGVQN---PLVSEKDKHSCLFKNFKSPF 180


>gi|28872505|ref|NP_795124.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213970795|ref|ZP_03398919.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato T1]
 gi|301383029|ref|ZP_07231447.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063434|ref|ZP_07254975.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato K40]
 gi|302130652|ref|ZP_07256642.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28855760|gb|AAO58819.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213924467|gb|EEB58038.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tomato T1]
          Length = 181

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  +E  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQEATGLTRQFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGRWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L   D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGE--PSLSAKDQQGKSLKDAD 178


>gi|297171427|gb|ADI22429.1| dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
           [uncultured Rhodospirillales bacterium HF0500_02H05]
          Length = 205

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 110/183 (60%), Gaps = 4/183 (2%)

Query: 4   NPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPP 62
            PV  +  R   D+RG F++T+     ++  + DV  VQ+N S S    T+RGLH+Q  P
Sbjct: 12  GPVLFVPNRH-RDARGVFAETFRVDEFRD-AIGDVDLVQENQSISHPINTVRGLHYQAEP 69

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KL+R + G + D+AVDIR +SPT+G  + +E+SA N  Q++IP GFAHGF TL  +
Sbjct: 70  HVQGKLMRVLQGAVLDVAVDIRPHSPTFGRHIKIELSAENWYQLWIPPGFAHGFKTLRPD 129

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           T V+YKV+D+YS  HD G+AW D  + I W L       VS+KD+  P    + + F   
Sbjct: 130 THVMYKVSDYYSPSHDHGIAWNDADLGIDWELYGQ-QAVVSDKDRQQPRFCDVTAQFMAG 188

Query: 183 GLP 185
            +P
Sbjct: 189 SIP 191


>gi|108759544|ref|YP_632778.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Myxococcus xanthus DK 1622]
 gi|108463424|gb|ABF88609.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Myxococcus xanthus DK 1622]
          Length = 183

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 114/185 (61%), Gaps = 9/185 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           + I  V +L+ + F D RG+F + + +     +G+   FVQDN+S S   GT+RG+HFQ 
Sbjct: 6   LEIPDVLLLEPKVFGDDRGFFMEMFHAARYAAVGIPGPFVQDNYSRSAK-GTLRGVHFQE 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           P  AQ KLV+ +AG ++D+AVD+RR SPT+G WV++E+S++N  Q++IP GFAHGF  + 
Sbjct: 65  P-QAQGKLVQVLAGAVYDVAVDVRRGSPTFGQWVAVELSSDNRRQLWIPPGFAHGFCVVS 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF- 179
            + +  YK T  Y+ E +  V W D  + I WP+ + +L   S KD   P L   D+P  
Sbjct: 124 DSADFHYKCTALYAPETERSVVWNDPDLAIPWPVSEPLL---SPKDAQAPRLR--DAPLL 178

Query: 180 -EYDG 183
            EY G
Sbjct: 179 PEYVG 183


>gi|322433923|ref|YP_004216135.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX9]
 gi|321161650|gb|ADW67355.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX9]
          Length = 184

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 108/179 (60%), Gaps = 11/179 (6%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPPY 63
           V++++ R+F D RGWF++ ++++     GL   FVQDN SFS   G +RGLH+Q  RP  
Sbjct: 11  VKLIRPRRFGDDRGWFAEMFNTQAFAANGLPAQFVQDNQSFSAK-GVLRGLHYQLERP-- 67

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQ----IYIPTGFAHGFMTL 119
            Q KLVRC++G I+D+AVD+RR SP +G W + ++   N       ++IP GFAHGF+ L
Sbjct: 68  -QGKLVRCLSGHIWDVAVDLRRESPDFGKWAAFDLKPLNDAGELELLWIPEGFAHGFLVL 126

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP 178
               EV+YK TD Y    +  V W D ++ I WP L+ I PS+S KD       + D P
Sbjct: 127 SETAEVLYKTTDLYHPLGERCVKWDDPTLAIPWP-LEGITPSISGKDALGKTFAEADLP 184


>gi|37678487|ref|NP_933096.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio vulnificus
           YJ016]
 gi|37197227|dbj|BAC93067.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio vulnificus
           YJ016]
          Length = 185

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 108/175 (61%), Gaps = 4/175 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  ++I++   F D RG+F +T+     +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   SIPEIKIIEPMVFGDERGFFMETWHQARFEELVTGKPTRFVQDNHSKS-KQGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
              + Q KLVR ++G +FD+AVDIR+ SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  MQ-HTQGKLVRVVSGEVFDVAVDIRQGSPTFGQWVGVYLSAENKRQMWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
               E +YK TD+Y  + +  +AW D  I I WP+     P +S+KD + P L++
Sbjct: 125 SEEAEFVYKCTDYYHPQSEQCIAWNDTVIGIDWPIPIGKGPMLSKKDASAPNLSE 179


>gi|29345874|ref|NP_809377.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29337767|gb|AAO75571.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 189

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVFIIEPRLFKDDRGYFFESFSQRKFNEKVRKVNFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G +VS+E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGKYVSVELTEDNHRQFFIPRGFAHGFSVLTDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + +  +AW D  + I W  P  + +L   SEKD +   L      F 
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDPDLGIDWRVPANEIVL---SEKDNHHELLKDASWLFN 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|126175090|ref|YP_001051239.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella baltica OS155]
 gi|125998295|gb|ABN62370.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella baltica OS155]
          Length = 187

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 107/168 (63%), Gaps = 6/168 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
            I  V+I++   + D RG+F +T++ +  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 13  KIPEVKIIEPAVYGDERGFFMETWNQQKFEELVTGKLTRFVQDNHSKS-KKGILRGLHYQ 71

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SP+YG WV   +SA N  Q+++P GFAHGF   
Sbjct: 72  TEN-TQGKLVRVVSGEVFDVAVDIRKDSPSYGYWVGEYLSAENKRQLWVPEGFAHGFYVT 130

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
               E +YK T++Y+   +  + W DKS+DI WP+  +  P +S+KDQ
Sbjct: 131 SEEAEFVYKCTNYYNPNSEVSILWSDKSLDIKWPIQSS--PELSKKDQ 176


>gi|315023084|gb|EFT36097.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Riemerella anatipestifer
           RA-YM]
 gi|325336323|gb|ADZ12597.1| dTDP-4-dehydrorhamnose 3,5-epimerase related enzyme [Riemerella
           anatipestifer RA-GD]
          Length = 181

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 4/166 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           I++   FED RG+F Q ++ K  ++L G+   FVQDN S S   G +RGLH Q+  +AQA
Sbjct: 13  IIEPTIFEDERGYFYQKFNEKKFEDLTGMNGHFVQDNISKS-SYGVLRGLHLQKGEHAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLV C+ G+++D+AVD+R +SP++G W  +E++A N LQ Y+P GFAHGF  L       
Sbjct: 72  KLVSCLEGKVWDVAVDLREDSPSFGKWYGVELTAENKLQFYVPRGFAHGFAVLSEMAVFA 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPF 171
           YK  +FY+ E + G+ W D  + I W L +T +  +SEKD+  LPF
Sbjct: 132 YKCDNFYNKESEGGILWNDADLAIDWKLDETDVI-LSEKDKVQLPF 176


>gi|300866607|ref|ZP_07111295.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillatoria sp. PCC 6506]
 gi|300335379|emb|CBN56455.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillatoria sp. PCC 6506]
          Length = 182

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 106/168 (63%), Gaps = 4/168 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I++ R F D RG+F ++++ +   E  G++  FVQDNHS S     +RGLH+Q 
Sbjct: 7   EIPEVLIIEPRVFGDDRGFFFESFNHRAFAEKTGVKAEFVQDNHSKSAQ-NVLRGLHYQM 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR   G IFD+AVDIR+NSPT+G WV   +SA N  Q+++P GFAHGF+ + 
Sbjct: 66  Q-QPQGKLVRVAMGEIFDVAVDIRKNSPTFGQWVGYLLSAENKRQLWVPAGFAHGFLVVS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
              EV+YK T++Y+ EH+  + W D  + I WPL D   P +S KD++
Sbjct: 125 EVAEVLYKTTEYYAPEHERCILWNDPDLAIAWPLGDAT-PILSAKDRS 171


>gi|265764217|ref|ZP_06092785.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
 gi|263256825|gb|EEZ28171.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
          Length = 190

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 111/180 (61%), Gaps = 4/180 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + IL+ R F+D RG+F ++++    +    Q  FVQDN S S   G IRGLHFQ+P
Sbjct: 7   SIEGLVILEPRLFQDDRGYFFESFNQWEFESNVCQTTFVQDNESKS-SYGVIRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR I G + D+AVDIR+ SPT+G  VS+E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVIKGAVLDVAVDIRKGSPTFGKHVSVELTEDNHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  +FY  E +  +AW D  ++I W +  D ++  +S KD   P L+ I+  F+
Sbjct: 126 EVIFQYKCDNFYHPEAEGAIAWNDPDLNIDWKIPQDRVI--LSGKDYTHPLLHNIELQFD 183


>gi|113868861|ref|YP_727350.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia eutropha H16]
 gi|113527637|emb|CAJ93982.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia eutropha H16]
          Length = 183

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 110/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V +++ + F D RG+F +T++++  ++  G++  FVQDNHS S     +RGLH+Q   + 
Sbjct: 13  VLVIEPQVFSDQRGFFMETFNAQAFEQATGIRRTFVQDNHSGSVR-NVLRGLHYQIQ-HP 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KL+R IAG +FD+AVD+R  SPTYG WV + +SA +  Q++IP GFAHGF+ L  + E
Sbjct: 71  QGKLIRVIAGEVFDVAVDVRLGSPTYGKWVGVTVSAADKKQLWIPEGFAHGFLVLSEHAE 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           V+YK TD++  EH+  + W D ++ + WPL     P ++ KD     L + D
Sbjct: 131 VLYKTTDYWYPEHERTLLWNDPAVGVRWPLNGA--PLLTAKDAAGKLLTEAD 180


>gi|83645209|ref|YP_433644.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hahella chejuensis KCTC 2396]
 gi|83633252|gb|ABC29219.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hahella chejuensis KCTC 2396]
          Length = 179

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 105/175 (60%), Gaps = 6/175 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            ++ V I++ R F D RG+F +TY  ++   E G++  FVQDNHS S   G +RGLHFQ+
Sbjct: 7   KLSGVVIIEPRVFGDHRGFFMETYQVARYRNEAGIELEFVQDNHSRS-GRGVLRGLHFQK 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR   G +FD+AVD+R+ S TYG W  + +S  N LQ YIP GFAHGF  L 
Sbjct: 66  TK-PQGKLVRVTQGEVFDVAVDLRKGSSTYGQWEGVILSGENHLQFYIPPGFAHGFCVLS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              +  YK TD+Y    + G+ W D  I I WP+     P++S+KD  LP L +I
Sbjct: 125 ETADFQYKCTDYYDPADEGGLIWNDPDIGIVWPIES---PNLSQKDLALPTLREI 176


>gi|307564467|ref|ZP_07627008.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella amnii CRIS 21A-A]
 gi|307346827|gb|EFN92123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella amnii CRIS 21A-A]
          Length = 184

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 110/168 (65%), Gaps = 3/168 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           NI  V ++K + F+D RG+F +++   +  K +G    F+QDN S S   G +RGLH+Q+
Sbjct: 7   NIKGVWLIKPKIFKDDRGYFFESFRQDEFDKNIGHHVEFIQDNESKS-SYGVLRGLHYQK 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             ++QAKLVR I G++ D+AVD+RR+S TYG +V++E+S  N  Q++IP GFAHGF+ L 
Sbjct: 66  GEFSQAKLVRIITGKVIDVAVDLRRSSTTYGKYVAVELSEENKCQLFIPRGFAHGFLVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
                 YKV + Y+ + ++ + W DK+I I WP +DT    +SEKD N
Sbjct: 126 KEAIFSYKVDNIYAPQSEASIKWNDKTIGIEWP-IDTKDIVLSEKDLN 172


>gi|327399838|ref|YP_004340707.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hippea maritima DSM 10411]
 gi|327182467|gb|AEA34648.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hippea maritima DSM 10411]
          Length = 191

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 113/177 (63%), Gaps = 5/177 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D+RG+F +T+   + ++   +  F+QDN S S   G +RGLH+Q PP+AQ
Sbjct: 11  VVIIELKVFGDNRGYFMETFRQDIFEKNVRKINFIQDNESKS-KRGVLRGLHYQLPPFAQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVR I G + D+AVDIR+ S T+G +V++E+S +N  Q++IP GFAHGF+        
Sbjct: 70  SKLVRVIKGSVIDVAVDIRKGSSTFGKYVAVELSEDNKKQLFIPRGFAHGFLVTSDEAIF 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
            YKV ++Y+ E+D  + + D  I+I W    D IL  VSEKD+N P L   +  FEY
Sbjct: 130 TYKVDNYYAPEYDRNIRFDDPDININWNFPKDKIL--VSEKDKNAPLLKDAEI-FEY 183


>gi|189461252|ref|ZP_03010037.1| hypothetical protein BACCOP_01902 [Bacteroides coprocola DSM 17136]
 gi|189432069|gb|EDV01054.1| hypothetical protein BACCOP_01902 [Bacteroides coprocola DSM 17136]
          Length = 189

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 109/181 (60%), Gaps = 6/181 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V I++ R F+D RG+F +++S +          FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IDGVVIIEPRLFKDDRGYFFESFSERDFNAQVRTVRFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ+KLVR + G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF  L   
Sbjct: 67  FAQSKLVRVVKGAVLDVAVDIRKGSPTFGQHVAVELTEENHRQFFIPRGFAHGFSVLTDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + +  +AW D ++ I W  P    IL   SEKD++ P L   D  F 
Sbjct: 127 VIFQYKCDNFYAPQSEGAIAWDDPALGIDWKIPAEKVIL---SEKDKHHPLLKDADWLFS 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|167757831|ref|ZP_02429958.1| hypothetical protein CLOSCI_00162 [Clostridium scindens ATCC 35704]
 gi|167664485|gb|EDS08615.1| hypothetical protein CLOSCI_00162 [Clostridium scindens ATCC 35704]
          Length = 202

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           DSRG+F +TY+ + ++E GL   FVQDN S S   G +RGLHFQ+  + Q KLVR I G 
Sbjct: 26  DSRGYFMETYNQRDMEEAGLTMNFVQDNQSCSTK-GVLRGLHFQKE-FPQGKLVRAIKGS 83

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R NS TYG W  +E++  N  Q YIP GFAHGF+ L    E  YK TDFY  
Sbjct: 84  VFDVAVDLRSNSETYGKWFGIELTEENKKQFYIPEGFAHGFLVLSEIAEFCYKCTDFYHP 143

Query: 136 EHDSGVAWQDKSIDITWPLL 155
             + G+AW D  I I WP L
Sbjct: 144 GDEGGLAWNDPEIGIKWPQL 163


>gi|253567875|ref|ZP_04845286.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 1_1_6]
 gi|251841948|gb|EES70028.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 1_1_6]
          Length = 189

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVFIIEPRLFKDDRGYFFESFSQREFNEKVRKVNFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G +VS+E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGKYVSVELTEDNHRQFFIPRGFAHGFSVLTDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + +  +AW D  + I W  P  + +L   SEKD +   L      F 
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDPDLGIDWRVPANEIVL---SEKDNHHELLKDASWLFN 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|288869616|ref|ZP_05975254.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobrevibacter smithii
           DSM 2374]
 gi|288860621|gb|EFC92919.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobrevibacter smithii
           DSM 2374]
          Length = 188

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 103/173 (59%), Gaps = 2/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   + D+RG+F +TY+ K  K+ G    FVQDN S SF  G +RGLH Q  
Sbjct: 13  DIEGMFVVEPAVYGDNRGYFMETYNEKDFKDAGYDLTFVQDNQSQSFK-GVLRGLHLQLK 71

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I G +FD+ VD+R +SPTYG W    +SA N  Q+YIP  FAHGF+ L  
Sbjct: 72  -YPQGKLVRVIKGEVFDVGVDLRADSPTYGKWYGEILSAENKKQLYIPPKFAHGFVVLSD 130

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T+FY  E + G+ W D  I + WPL      ++S+KD+    L +
Sbjct: 131 EAEFVYKCTEFYHGEDEGGIMWNDPDIAVEWPLGGIDEITLSDKDKKWKTLKE 183


>gi|160893016|ref|ZP_02073804.1| hypothetical protein CLOL250_00554 [Clostridium sp. L2-50]
 gi|156865099|gb|EDO58530.1| hypothetical protein CLOL250_00554 [Clostridium sp. L2-50]
          Length = 200

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 94/151 (62%), Gaps = 2/151 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++     DSRG+F +TY+ K ++E GL  VFVQDN S S   G +RGLHFQ+  
Sbjct: 11  IEGLYIIEPAVHGDSRGYFMETYNQKDMEENGLNMVFVQDNQSMS-TKGVLRGLHFQKE- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G ++D+AVD+R  S TYG W  +E++  N  Q YI  GFAHGF+ L   
Sbjct: 69  FPQGKLVRVIKGAVYDVAVDLRSGSETYGKWYGVELTEENKKQFYISEGFAHGFLVLSDT 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWP 153
            E  YKVTDFY    + G+AW D  I I WP
Sbjct: 129 AEFCYKVTDFYHPGDEGGLAWNDPEIGIEWP 159


>gi|291460665|ref|ZP_06600055.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oribacterium sp. oral taxon
           078 str. F0262]
 gi|291416624|gb|EFE90343.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oribacterium sp. oral taxon
           078 str. F0262]
          Length = 213

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (60%), Gaps = 5/163 (3%)

Query: 5   PVR---ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           P+R   I++     DSRG+F +TY+ + ++E GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 19  PIRGLYIIEPAVHGDSRGYFMETYNQRDMEEAGLNMRFVQDNQSMSVR-GVLRGLHFQKQ 77

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I GR++D+AVD+R  S +YG    +E++A N  Q YI  GFAHGF+ L  
Sbjct: 78  -YPQGKLVRVIRGRVYDVAVDLREGSESYGEHFGVELTAENHRQFYISEGFAHGFLVLSE 136

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
             E  YKVTDFY    + G+AW D  + I WP L    P  ++
Sbjct: 137 EAEFCYKVTDFYRPGDEGGIAWNDPELHIDWPELTGTYPGSAD 179


>gi|146280479|ref|YP_001170632.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas stutzeri A1501]
 gi|14717005|emb|CAC44167.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas stutzeri]
 gi|145568684|gb|ABP77790.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas stutzeri A1501]
          Length = 181

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 109/167 (65%), Gaps = 7/167 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +I  V I++ + F D RG+F +++++   +   GL+  FVQDNHS S   G +RGLH+Q 
Sbjct: 7   SIPDVLIIEPKVFGDERGFFYESFNAAAFEAATGLKRQFVQDNHSKS-QRGVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR +AG +FD+AVD+R++SP++G W    +SA N  Q++IP GFAHGF+ L
Sbjct: 66  QQP--QGKLVRVVAGEVFDVAVDLRKSSPSFGRWFGTHLSAQNQRQLWIPEGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             + E +YK TD+Y+ EH+  + W D  + I WPL +   P +S KD
Sbjct: 124 SESAEFLYKTTDYYAPEHERSLLWNDPELGIEWPLDEA--PQLSAKD 168


>gi|325662387|ref|ZP_08150996.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471389|gb|EGC74612.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 185

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 100/166 (60%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  ++++    F D RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ   
Sbjct: 11  IEGLKVITPTVFGDERGYFMETYNYNDYKEAGIDMEFVQDNQSSS-KKGVLRGLHFQ-IN 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR ++G +FD+AVD+R  S TYG W  + +SA N  Q +IP  FAHGF+ L   
Sbjct: 69  FPQDKLVRVVSGEVFDVAVDLREGSKTYGQWYGVLLSAENKKQFFIPKDFAHGFLVLSDT 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E  YK TDFY    + G+AW D  I I WP+ + +  ++SEKDQ 
Sbjct: 129 AEFAYKCTDFYHPNDEGGLAWNDPDIGIQWPIPEGMELTISEKDQK 174


>gi|313676578|ref|YP_004054574.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Marivirga tractuosa DSM 4126]
 gi|312943276|gb|ADR22466.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Marivirga tractuosa DSM 4126]
          Length = 192

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 114/186 (61%), Gaps = 10/186 (5%)

Query: 1   MNINPVR-----ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIR 54
           MNI P       I++   +EDSRG+F +++  K  ++  G++  FVQDN S S   G IR
Sbjct: 10  MNITPTDFDDLFIIEPTVYEDSRGYFFESFHQKKFEDATGIKCEFVQDNQSRSLH-GVIR 68

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH Q PP AQAKLVR + G + D+ VD+R++ PT+G   S+ +SA N  Q++IP GFAH
Sbjct: 69  GLHMQVPPMAQAKLVRVLRGEVLDVVVDLRKDKPTFGKSFSIHLSAENKQQLFIPRGFAH 128

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPFLN 173
           G   L    E  YK  ++YS E++ G+ + D S++I W  +D+    +SEKDQ NL F +
Sbjct: 129 GIAVLSKEAEFFYKCDNYYSPENERGIIYNDASLNIDWK-IDSEKRIISEKDQKNLDFFS 187

Query: 174 QIDSPF 179
              SPF
Sbjct: 188 -FSSPF 192


>gi|187476639|ref|YP_784662.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Bordetella avium 197N]
 gi|115421225|emb|CAJ47730.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Bordetella avium 197N]
          Length = 190

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 114/194 (58%), Gaps = 15/194 (7%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKL----LKELGLQ--DVFVQDNHSFSFD 49
           MN +P     V +L  + F D+RGWF++ +   +    L+ LGL     FVQ+NHS S  
Sbjct: 1   MNFSPTTLPGVVLLDPKVFADARGWFAERFRQDVFEAGLRALGLPVPAPFVQENHSCSRQ 60

Query: 50  CGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIP 109
            G +RGLH+Q  P+AQ KLV    G IFD+ VDIR +SPT+G W  + +SA N   ++IP
Sbjct: 61  -GVLRGLHYQLAPHAQGKLVSVAVGEIFDVTVDIRPDSPTFGRWQGVTLSAVNRRSLWIP 119

Query: 110 TGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNL 169
            G+AHGF++L   +EV YK T +YS  H+  + W D  + I WP   ++L   SE+D+  
Sbjct: 120 AGYAHGFLSLSGPSEVHYKTTAYYSPAHERSLRWNDPFMGIVWPAEVSLL---SERDERA 176

Query: 170 PFLNQIDSPFEYDG 183
           P L +  +  + DG
Sbjct: 177 PGLQEALASGQLDG 190


>gi|298484711|ref|ZP_07002813.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160744|gb|EFI01763.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 181

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQAATGLTREFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  N E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSENAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGQ--PNLSAKDQQGKRLEEAD 178


>gi|60680555|ref|YP_210699.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides fragilis NCTC
           9343]
 gi|253563576|ref|ZP_04841033.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides sp. 3_2_5]
 gi|5199112|gb|AAD40710.1|AF048749_6 dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides fragilis]
 gi|60491989|emb|CAH06750.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides fragilis NCTC
           9343]
 gi|251947352|gb|EES87634.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides sp. 3_2_5]
          Length = 182

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 107/175 (61%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + IL+ + F+D RG+F ++++ +  +E   +  FVQDN S S   G IRGLHFQ+PP
Sbjct: 8   IEGLVILEPQLFKDDRGYFFESFNQREFEEKVCKTTFVQDNESKS-SYGVIRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ+KLVR I G + D+AVDIR+ SPT+G  VS+E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  FAQSKLVRVIKGAVLDVAVDIRKGSPTFGKHVSVELTEDNHRQFFIPRGFAHGFSVLSEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQI 175
               YK  +FY  E +  +AW D  + I W  P    IL   S+KD+  P L  I
Sbjct: 127 VIFQYKCDNFYHPEAEGAIAWNDPDLGIEWRVPCKSIIL---SKKDRVHPLLKYI 178


>gi|253579894|ref|ZP_04857162.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848893|gb|EES76855.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 184

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 101/165 (61%), Gaps = 2/165 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  +++++   F D+RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ  
Sbjct: 11  GIKGLKVVEPTVFGDARGYFMETYNYNDFKEAGIDVEFVQDNQSSSHK-GVLRGLHFQ-I 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G +FD+AVD+R  S TYG W  + +SA N  Q +IP GFAHGF+ L  
Sbjct: 69  NYPQDKLVRVVNGEVFDVAVDLREGSETYGKWFGVVLSAENKKQFFIPKGFAHGFLVLSE 128

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           + E +YK +DFY    + G+ W D  I + WP+ + +  S S+KD
Sbjct: 129 HAEFVYKCSDFYHPNDEGGLIWNDPDIGVEWPIPEGMELSFSDKD 173


>gi|251771903|gb|EES52477.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leptospirillum
           ferrodiazotrophum]
          Length = 184

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 102/170 (60%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V +L  +   DSRG+F +++ +K    LGL  +FVQDNHS S   G  RGLH+Q+  + Q
Sbjct: 11  VLLLVPKVHGDSRGFFLESFHAKTFSRLGLPQLFVQDNHSRSVR-GVTRGLHYQKR-HGQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G +FD+AVD+R +SPT+  W    +S  N   +YIP GFAHGF     + + 
Sbjct: 69  GKLVRVVRGSVFDVAVDLRPDSPTFSRWFGTTLSEENHAMLYIPEGFAHGFQVTSESADF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           +YK TDFY  + + G+ W D  + + WP+ +  L   S+KD  LP L+ +
Sbjct: 129 LYKCTDFYDPQDEGGILWNDPEVGVVWPIAEAAL---SKKDAALPLLSAV 175


>gi|29726002|gb|AAO88932.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
          Length = 183

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 7/167 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GF HGF   
Sbjct: 66  TEN-TQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWIPKGFLHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             + E +YK TD+YS EH+  + W D  ++I WP    IL   SEKD
Sbjct: 125 SESAEFVYKCTDYYSPEHEVSIIWNDVDLNIKWPSGRYIL---SEKD 168


>gi|198276704|ref|ZP_03209235.1| hypothetical protein BACPLE_02903 [Bacteroides plebeius DSM 17135]
 gi|198270229|gb|EDY94499.1| hypothetical protein BACPLE_02903 [Bacteroides plebeius DSM 17135]
          Length = 191

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 112/183 (61%), Gaps = 8/183 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
            I  V I++ R F+D RG+F +++S +   +      FVQDN S S  C G +RGLHFQ+
Sbjct: 7   EIEGVVIIEPRLFKDERGYFFESFSQRDFDKQVRTIHFVQDNESKS--CYGVLRGLHFQK 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ+KLVR I G + D+AVDIR+ SPT+G  V++E++ +N  Q +IP GFAHGF  L 
Sbjct: 65  PPFAQSKLVRVIKGAVLDVAVDIRKGSPTFGQHVAVELTEDNHRQFFIPRGFAHGFSVLS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSP 178
                 YK  +FY+ + +  +AW D ++ I W  P    IL   SEKD++ P L   +  
Sbjct: 125 DEVIFQYKCDNFYAPQSEGAIAWNDPALKIDWRIPTEKVIL---SEKDKHHPLLADAEWL 181

Query: 179 FEY 181
           F+Y
Sbjct: 182 FDY 184


>gi|330874358|gb|EGH08507.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 181

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  ++  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQQATGLTRQFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L   D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQF--DAEPSLSAKDQQGKSLKDAD 178


>gi|120612800|ref|YP_972478.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax citrulli AAC00-1]
 gi|120591264|gb|ABM34704.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax citrulli AAC00-1]
          Length = 181

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (61%), Gaps = 12/183 (6%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIR 54
           MN+ P     V +L+ + F D+RG+F ++++ +   E  G +  FVQDNHS S   G +R
Sbjct: 1   MNVLPTSIPDVVVLEPKVFGDARGFFFESFNQRAFDEATGSRHAFVQDNHSRS-ARGVLR 59

Query: 55  GLHFQ-RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFA 113
           GLH+Q R P  Q KLVR + G +FD+AVD+RR+SPT+G WV  E+S  N  Q+++P GFA
Sbjct: 60  GLHYQIRQP--QGKLVRVVRGTVFDVAVDLRRSSPTFGQWVGEELSEENQRQMWVPPGFA 117

Query: 114 HGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           HGF+ L  + + +YK TD+Y+ EH+  +AW D  + I W       PS+S KD     L 
Sbjct: 118 HGFVVLSESADFLYKTTDYYAPEHERCIAWNDPELGIDWRFAGE--PSLSAKDAKGAALR 175

Query: 174 QID 176
           + +
Sbjct: 176 EAE 178


>gi|319791467|ref|YP_004153107.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Variovorax paradoxus EPS]
 gi|315593930|gb|ADU34996.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Variovorax paradoxus EPS]
          Length = 184

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 112/181 (61%), Gaps = 11/181 (6%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIR 54
           M I+P     V IL+ + F D+RG+F ++Y+ ++ +     D+ F QDNHS S   G +R
Sbjct: 1   MKISPTIIPDVLILEPKVFGDARGFFLESYNEEVFRRATGSDLAFKQDNHSRS-SKGVLR 59

Query: 55  GLHFQ-RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFA 113
           GLH+Q + P  Q KLVR + G +FD+AVDIR  SPT+G WV +E++ +N  Q+++P G A
Sbjct: 60  GLHYQVKQP--QGKLVRVVQGAVFDVAVDIRPTSPTFGKWVGVELNESNHRQLWVPPGLA 117

Query: 114 HGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           HGF+ L    + +YK TD+Y+  H+  +AW D +I I WP L    P +S KD   P L 
Sbjct: 118 HGFLVLSETADFLYKTTDYYAPAHERSIAWNDPAIGIDWP-LSGASPVLSAKDAAAPTLA 176

Query: 174 Q 174
           +
Sbjct: 177 E 177


>gi|330815727|ref|YP_004359432.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia gladioli BSR3]
 gi|327368120|gb|AEA59476.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia gladioli BSR3]
          Length = 183

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 112/175 (64%), Gaps = 5/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           ++ V+I++ + F D+RG+F ++++ +   E +  Q VFVQDNHS S   G +RGLH+Q  
Sbjct: 10  LSEVKIIEPKVFGDARGFFYESFNGREFAEKVDPQAVFVQDNHSRS-ARGVLRGLHYQ-I 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQ KLVR IAG + D+AVDIR++SP +G WV + +SA N  Q+++P GFAHGF+TL  
Sbjct: 68  EHAQGKLVRVIAGEVLDVAVDIRKSSPNFGKWVGVRLSAENARQLWVPPGFAHGFVTLSE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           + E +YK TD++  E +  + W D ++ I W +     P ++ KD     L Q D
Sbjct: 128 SAEFLYKTTDYWYPEFERSIVWNDPALGIDWQI--DFEPQLAAKDAAGSRLAQAD 180


>gi|296121781|ref|YP_003629559.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Planctomyces limnophilus DSM
           3776]
 gi|296014121|gb|ADG67360.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Planctomyces limnophilus DSM
           3776]
          Length = 181

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 105/171 (61%), Gaps = 8/171 (4%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPPYAQA 66
           ++ R F DSRG+F + +  +     GL   FVQDN S S   GT+RGLHFQ  RP   QA
Sbjct: 15  IEPRVFGDSRGFFFEVFQQERYSSSGLSQAFVQDNVSRS-SRGTLRGLHFQLVRP---QA 70

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KL++ I G IFD+AVD+R++SPT+G W    +S  N  Q+YIP GFAHGF  +    +V+
Sbjct: 71  KLIQVIRGEIFDVAVDVRKSSPTFGQWTGYRLSDVNHHQLYIPAGFAHGFCVISETADVL 130

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           YK TD+Y  +H+  + W D ++ I WPL D   P +S KDQ    L  ++S
Sbjct: 131 YKCTDYYFPQHERCLLWNDPAVGIAWPLED--FPILSAKDQQGQTLANLES 179


>gi|224539523|ref|ZP_03680062.1| hypothetical protein BACCELL_04428 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518861|gb|EEF87966.1| hypothetical protein BACCELL_04428 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 182

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 111/175 (63%), Gaps = 4/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++   F+D RG+F ++++ +  +E   +  FVQDN S S   G IRGLHFQ+PP
Sbjct: 8   IEGVVIIEPHLFKDERGYFFESFNQREFEEKVCKTTFVQDNESKS-SYGVIRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ+KLVR + G + D+AVDIR+ SPT+G  V++E++ NN  Q++IP GFAHGF  L   
Sbjct: 67  FAQSKLVRVVKGAVLDVAVDIRKGSPTFGKHVAVELTENNHCQLFIPRGFAHGFSVLSEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQID 176
               YK  + Y+ E +  +AW D  + I W + +D +L  +SEKD+    L +++
Sbjct: 127 VIFQYKCDNKYAPESEGAIAWGDPDLRIDWRIPMDKVL--LSEKDKQHSNLKEVN 179


>gi|296315137|ref|ZP_06865078.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria polysaccharea ATCC
           43768]
 gi|296837942|gb|EFH21880.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria polysaccharea ATCC
           43768]
          Length = 185

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 99/161 (61%), Gaps = 4/161 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+ILK + F+D RG+F +T+     KE      FVQ+NHS S   G +RGLH+Q     Q
Sbjct: 11  VKILKPQVFKDGRGFFMETFRDGWFKENIADRNFVQENHSQSRK-GVLRGLHYQTE-NTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR IAG +FD+AVD+R  SPT+G W    +SA N  Q++IP GFAHGF  L    EV
Sbjct: 69  GKLVRAIAGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGFAHGFYVLSDTAEV 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y  E +  + W D +I I WPL  T  P +S KD
Sbjct: 129 MYKCTDYYKPEAEQVLIWNDPAIGIGWPLQTT--PLLSPKD 167


>gi|296274085|ref|YP_003656716.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arcobacter nitrofigilis DSM
           7299]
 gi|296098259|gb|ADG94209.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arcobacter nitrofigilis DSM
           7299]
          Length = 189

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 112/182 (61%), Gaps = 1/182 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V IL    F D RG+F ++YS +   E GL   F+QDN S++    T RG H+Q  P
Sbjct: 8   LDGVLILNPHVFNDERGFFYESYSKRKFLENGLDYNFIQDNQSYNKYKHTFRGFHYQMNP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            +Q  LVR ++G I D  +DIR+ SPTYG +VS  +S++N  Q+ IP GFAHG++TL  N
Sbjct: 68  KSQTTLVRVVSGEIIDYVIDIRKKSPTYGQYVSQILSSDNHKQMLIPKGFAHGYLTLTDN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
             ++YK+ + YS  HD  + + D +I+I   +  + L  +++KD + P L QID+ F Y+
Sbjct: 128 VTILYKMDELYSPNHDRILNFMDSTINIKLNIDKSELI-IADKDNSAPMLAQIDNNFLYE 186

Query: 183 GL 184
            +
Sbjct: 187 EM 188


>gi|224023786|ref|ZP_03642152.1| hypothetical protein BACCOPRO_00502 [Bacteroides coprophilus DSM
           18228]
 gi|224017008|gb|EEF75020.1| hypothetical protein BACCOPRO_00502 [Bacteroides coprophilus DSM
           18228]
          Length = 189

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (61%), Gaps = 4/176 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           IL+ R F D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP+ Q+K
Sbjct: 13  ILEPRIFRDDRGYFFESFSQRTFNEEVREIHFVQDNESKS-SYGVVRGLHFQKPPFTQSK 71

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR I G + D+AVDIRR SPT+G +V +E++  N  Q ++P GFAHGF  L       Y
Sbjct: 72  LVRVIQGAVLDVAVDIRRGSPTFGQYVKVELTGENHRQFFVPRGFAHGFSVLTDEVVFQY 131

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           K  +FY+ + +  +AW D  + I W +  D ++  +SEKD++ P L   +  F+++
Sbjct: 132 KCDNFYAPQSEGAIAWDDPDLGIDWQIPADKVI--LSEKDKHHPRLKDAEWLFDWN 185


>gi|224535678|ref|ZP_03676217.1| hypothetical protein BACCELL_00542 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522716|gb|EEF91821.1| hypothetical protein BACCELL_00542 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 189

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 6/181 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG F ++++ K  +E   +  FVQDN S S   G IRGLHFQ+ P
Sbjct: 8   IEGVVIIEPRLFKDGRGCFFESFNQKEFEEKVCKTTFVQDNESKS-SYGVIRGLHFQKTP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ+KLVR + G + D+AVDIR+ SPT+G  V++E++ NN  Q++IP GFAHGF  L   
Sbjct: 67  FAQSKLVRVVKGTVLDVAVDIRKGSPTFGQHVAVELTENNYRQLFIPRGFAHGFSVLSEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY  + +  +AW D  ++I W  P  + IL   SEKD+  P L   +  F+
Sbjct: 127 VVFQYKCDNFYVPQSECALAWDDLELNIDWRIPAENVIL---SEKDRAHPNLRNSEWLFD 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|224184715|gb|ACN39588.1| putative dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga
           canimorsus]
          Length = 189

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 107/174 (61%), Gaps = 6/174 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++   F D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   EIKDVIIIEPEIFGDERGYFFESFSQEKFVEQVCKTTFVQDNESKS-RYGVVRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P++Q+KLVR + G++ D+AVDIR+ SPT+G  V++E+SA N  Q+++P GFAHGF  L  
Sbjct: 66  PFSQSKLVRVVVGKVLDVAVDIRKGSPTFGKHVAVELSAENKRQLFVPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
                YK  ++Y+ + +  V W D ++ I W  P  D IL   S+KD+  P L 
Sbjct: 126 EVIFQYKCDNYYNPKEEGSVLWNDPALQIDWKIPHQDIIL---SQKDKESPLLK 176


>gi|167623420|ref|YP_001673714.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella halifaxensis
           HAW-EB4]
 gi|167353442|gb|ABZ76055.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella halifaxensis
           HAW-EB4]
          Length = 184

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 109/169 (64%), Gaps = 6/169 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   SIPDVKIIEPSVFGDERGFFMETWNQKKFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR+ SPT+G WV   +SA+N  Q+++P GFAHGF   
Sbjct: 66  IEN-TQGKLVRVVSGEVFDVAVDIRKGSPTFGQWVGEYLSADNKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               E +YK TDFY+ + +  + W D+S+ I WPL  + +P +SEKD N
Sbjct: 125 SNEAEFVYKCTDFYNPKAEISLFWADESLAINWPL--SGIPMLSEKDIN 171


>gi|294645676|ref|ZP_06723363.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides ovatus SD CC 2a]
 gi|292638955|gb|EFF57286.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides ovatus SD CC 2a]
          Length = 179

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 113/178 (63%), Gaps = 4/178 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PPYAQ
Sbjct: 1   VVIIEPRLFKDDRGYFFESFSQREFTEKVRKVDFVQDNESKS-SYGVLRGLHFQKPPYAQ 59

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVR I G + D+AVDIR+ SPT+G  V++E++  N  Q +IP GFAHGF+ L      
Sbjct: 60  SKLVRVIKGSVLDVAVDIRKGSPTFGEHVAVELTEENHRQFFIPRGFAHGFVVLTEEVIF 119

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEYD 182
            YK  +FY+ + +  +AW D ++ I W +  D I+  +SEKD++   L +    F+Y+
Sbjct: 120 QYKCDNFYAPQCEGALAWDDPALKIDWKVPADKII--LSEKDKHHERLEEASWLFDYN 175


>gi|167586360|ref|ZP_02378748.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ubonensis Bu]
          Length = 183

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 111/162 (68%), Gaps = 5/162 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   E     V FVQDNHS S + G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGYFYESFNAREFAEQVEPGVEFVQDNHSRS-EKGVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR I G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF+ L  + E
Sbjct: 71  QGKLVRVIQGEVFDVAVDIRKSSPTFGEWVGVYLSAANHRQLWVPAGFAHGFLALTASCE 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            +YK TDF+  E++  + W D  + ITWP LDT  P ++ KD
Sbjct: 131 FLYKTTDFWYPEYERCLQWNDPDVGITWP-LDT-PPVLATKD 170


>gi|300776431|ref|ZP_07086289.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chryseobacterium gleum ATCC
           35910]
 gi|300501941|gb|EFK33081.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chryseobacterium gleum ATCC
           35910]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 7/166 (4%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           I++   FED RG+F + ++ K  +EL G+   FVQDN S S   G +RGLH Q+  +AQA
Sbjct: 13  IIEPTIFEDERGYFFEKFNEKKFEELTGMNGHFVQDNISKS-SYGVLRGLHLQKGEHAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLV C+ G ++D+AVD+R +SPT+G W  +E++A N LQ+Y+P GF HGF  L  +    
Sbjct: 72  KLVSCLEGSVWDVAVDLREDSPTFGKWFGIELTAENKLQLYVPRGFGHGFSVLSTHAVFS 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLP 170
           YK  +FYS E +  V + D  ++I W +   D IL   SEKDQN P
Sbjct: 132 YKCDNFYSKESEGSVKFNDPDLNIDWKVDEKDAIL---SEKDQNAP 174


>gi|331018758|gb|EGH98814.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (61%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  +E  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQEATGLTRQFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRTSPNFGRWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L   D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFNGE--PSLSVKDQQGKSLKDAD 178


>gi|253563189|ref|ZP_04840646.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_2_5]
 gi|265762927|ref|ZP_06091495.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
 gi|251946965|gb|EES87247.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_2_5]
 gi|263255535|gb|EEZ26881.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_16]
          Length = 191

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ R F D RG+F ++++  +  E   + +FVQDN S S   G IRGLHFQ+P
Sbjct: 7   DIKSVVIIEPRLFRDERGYFFESFNQNVFIEKVCKTMFVQDNESKS-SYGVIRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D+AVDIR+ SPT+G  +S+E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVVKGAVLDVAVDIRKGSPTFGKHISVELTEDNHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY+ + +  +AW D  + I W  P+ + IL   SEKD     L      F
Sbjct: 126 EVVFQYKCDNFYAPQCEGAIAWDDPDLGIDWKIPMEEVIL---SEKDSCHSALKDAAWLF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|225016237|ref|ZP_03705429.1| hypothetical protein CLOSTMETH_00140 [Clostridium methylpentosum
           DSM 5476]
 gi|224950995|gb|EEG32204.1| hypothetical protein CLOSTMETH_00140 [Clostridium methylpentosum
           DSM 5476]
          Length = 182

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 102/174 (58%), Gaps = 2/174 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I+   +F+D+RG+F +TY+ +     GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  GIKDLYIIDNARFDDARGYFMETYNKQDFDAAGLTMNFVQDNQSKS-TKGVLRGLHFQKT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR   G ++D+AVD+R  S TYG W  + +S  N  Q Y+P GFAHGF+ L  
Sbjct: 69  -HPQGKLVRVTKGAVYDVAVDLRPGSETYGKWHGVTLSEENHRQFYVPEGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             E +YK TDFY  E +  + W D  + I WP+ + +   +S+KD+  P L  I
Sbjct: 128 VAEFVYKCTDFYHPEDEGALFWNDPDVGIDWPITEDMTILLSDKDKKNPLLKDI 181


>gi|33591366|ref|NP_879010.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella pertussis Tohama
           I]
 gi|33594889|ref|NP_882532.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella parapertussis
           12822]
 gi|33599164|ref|NP_886724.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella bronchiseptica
           RB50]
 gi|33564965|emb|CAE39912.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella parapertussis]
 gi|33571008|emb|CAE40487.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella pertussis Tohama
           I]
 gi|33575210|emb|CAE30673.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella bronchiseptica
           RB50]
 gi|332380767|gb|AEE65614.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bordetella pertussis CS]
          Length = 182

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 112/178 (62%), Gaps = 4/178 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D RG F ++++  +L  +LG +  FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRFVQDNHSCS-RAGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
              + QAKLVR +AG  +D+AVD+RR SPT+G W    +SA N  Q++IP GFAHGF+ L
Sbjct: 65  -ILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSARNRHQLWIPEGFAHGFLAL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
             +TE +YK TD+Y+ EH+  V W D  + + WPL     P +S KD+    L + D+
Sbjct: 124 SDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQA-PILSVKDRQGVALARADT 180


>gi|332885219|gb|EGK05470.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Dysgonomonas mossii DSM
           22836]
          Length = 197

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 108/183 (59%), Gaps = 8/183 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQRP 61
           I  V I++ + F D RG+F ++Y+            FVQDN S S  C G +RGLHFQ+P
Sbjct: 9   IKDVVIIEPKIFGDDRGYFFESYNQAEFNTSIRTVHFVQDNESKS--CYGVLRGLHFQKP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR I G + D+AVDIRRNSPT+G  V++ +S  N  Q++IP GFAHGF+ L  
Sbjct: 67  PFAQSKLVRVIEGEVLDVAVDIRRNSPTFGKHVAVILSGENHRQLFIPRGFAHGFVVLSN 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSPF 179
                YK  + YS + +  +AW D  I I W +   D IL   SEKD   PFL      F
Sbjct: 127 EAVFQYKCDNSYSPQSEGAIAWNDPEIGIDWIVAPEDIIL---SEKDTRHPFLKDATQLF 183

Query: 180 EYD 182
           +Y+
Sbjct: 184 DYN 186


>gi|315225494|ref|ZP_07867307.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga ochracea
           F0287]
 gi|314944592|gb|EFS96628.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga ochracea
           F0287]
          Length = 182

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/171 (42%), Positives = 104/171 (60%), Gaps = 2/171 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++ + F D RG+F +++S +   EL    VFVQDN S S   G +RGLHFQ+P
Sbjct: 7   KIEGVVIIEPQVFFDGRGYFFESFSQQRFNELVSPTVFVQDNESQS-TYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQAKLVR + G + D+AVD+R  SP++G + S+ ++  N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQAKLVRVVKGEVLDVAVDLREGSPSFGQYESVILNEENKRQFFIPRGFAHGFAVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
                YK  ++Y+ E +  V W D +I I W L   ++  +SEKD+  P L
Sbjct: 126 EAIFQYKCDNYYAPESEGSVRWDDPTIGIDWRLPAEVI-QLSEKDKKAPLL 175


>gi|148549129|ref|YP_001269231.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida F1]
 gi|148513187|gb|ABQ80047.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas putida F1]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 5/167 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + + F D RG+F ++++ K+ +E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVVLFEPKVFGDQRGFFYESFNQKVFEEVVGRSVTFVQDNHSKSVK-GVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
              +AQ KLVR   G +FD+AVD+R++SPT+G WV   +S+ N  Q++IP GFAHGF+ L
Sbjct: 65  IK-HAQGKLVRVTHGEVFDVAVDLRKSSPTFGQWVGAHLSSTNQHQLWIPEGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E +YK TD+++ + +  +AW D ++ I WP  D   P++S KD
Sbjct: 124 SETAEFLYKTTDYWAPKFERSLAWNDPTVAIEWPYTDA--PTLSAKD 168


>gi|319761364|ref|YP_004125301.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Alicycliphilus denitrificans
           BC]
 gi|317115925|gb|ADU98413.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicycliphilus denitrificans
           BC]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 109/169 (64%), Gaps = 7/169 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F ++++ K   E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVVLIEPKVFGDARGFFFESFNQKAFDEATGTHFQFVQDNHSRS-GRGVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR + G ++D+AVDIRRNSPT+G WV  E+S +N  Q+++P GFAHGF+ 
Sbjct: 65  VQQP--QGKLVRVVRGAVWDVAVDIRRNSPTFGRWVGAELSEDNQRQLWVPPGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           L  + + +YK TD+Y+ +H+  +AW D  + I WP      P +S KDQ
Sbjct: 123 LSESADFLYKTTDYYAPQHERCIAWNDAQLAIAWPYAGE--PVLSAKDQ 169


>gi|115279744|gb|ABI85360.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
          Length = 183

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 112/176 (63%), Gaps = 5/176 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++     D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVLGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               E +YK TD+Y+   +  ++W D  ++ITWP  +   P +SEKD+N   L++I
Sbjct: 125 SDEAEFVYKCTDYYNPTAEISLSWDDPDLEITWPNFNQ-SPILSEKDKNPISLDKI 179


>gi|121592970|ref|YP_984866.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax sp. JS42]
 gi|120605050|gb|ABM40790.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidovorax sp. JS42]
          Length = 182

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 116/180 (64%), Gaps = 6/180 (3%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F ++++ +   E+ G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVVLIEPKVFGDARGFFFESFNQRAFNEVTGTNHHFVQDNHSRS-TKGVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR + G +FD+AVDIR++S T+G WV +E+SA N  Q+++P GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVVQGAVFDVAVDIRKSSATFGQWVGVELSAENHRQLWVPPGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP 178
           L    + +YK TD+Y+ +++  +AW D ++ I WP L  + P++S KD     L Q + P
Sbjct: 123 LSDTADFLYKTTDYYAPQYERCIAWNDPTLAIAWPDLG-MRPTLSAKDGAGKLLQQAELP 181


>gi|284035367|ref|YP_003385297.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirosoma linguale DSM 74]
 gi|283814660|gb|ADB36498.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirosoma linguale DSM 74]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 104/167 (62%), Gaps = 5/167 (2%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           L  R FED RG F ++Y+  L + LGL   FVQDN SFS   G +RGLH Q  P+AQ KL
Sbjct: 14  LTPRVFEDERGHFFESYNKPLFESLGLPMDFVQDNQSFS-TKGVLRGLHMQNQPFAQGKL 72

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           VR I+G++ DIAVD+R +SPT+G + +  + A      YIP GFAHGF+ LE ++   YK
Sbjct: 73  VRVISGQVLDIAVDLRPDSPTFGQYEAFLLDAKRANMAYIPEGFAHGFVALE-DSVFSYK 131

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            T+ Y+   +SG+ W D  ++I W + +   P VSEKD+ L    ++
Sbjct: 132 CTNVYNKAAESGIIWNDPDLNIDWGIAN---PIVSEKDKELKLFREV 175


>gi|66048160|ref|YP_238001.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63258867|gb|AAY39963.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F +++++K  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNAKAFQAATGLTREFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWDDADLAIDWQFDGQ--PNLSAKDQQGKRLKEAD 178


>gi|330823239|ref|YP_004386542.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicycliphilus denitrificans
           K601]
 gi|329308611|gb|AEB83026.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alicycliphilus denitrificans
           K601]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 109/169 (64%), Gaps = 7/169 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +++ + F D+RG+F ++++ K   E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   LAIPDVVLIEPKVFGDARGFFFESFNQKAFDEATGTNFQFVQDNHSRS-GRGVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR + G ++D+AVDIRRNSPT+G WV  E+S +N  Q+++P GFAHGF+ 
Sbjct: 65  VQQP--QGKLVRVVRGAVWDVAVDIRRNSPTFGRWVGAELSEDNQRQLWVPPGFAHGFVA 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           L  + + +YK TD+Y+ +H+  +AW D  + I WP      P +S KDQ
Sbjct: 123 LSESADFLYKTTDYYAPQHERCIAWNDAQLAIAWPYAGE--PVLSAKDQ 169


>gi|115350807|ref|YP_772646.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria AMMD]
 gi|115280795|gb|ABI86312.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria AMMD]
          Length = 183

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 112/172 (65%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   E    DV FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIVEPKVFGDARGYFYESFNAREFAEHVAADVEFVQDNHSRSAK-GVLRGLHYQ-IRHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR+SP +G WV + +SA N  Q++IP GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRSSPDFGKWVGVVLSAENHRQVWIPPGFAHGFVVLSDAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  EH+  + W D +I I WP+   + P ++ KD     L++ +
Sbjct: 131 FLYKTTDYWYPEHERCIVWNDPAIGIEWPV--DVDPLLAAKDAAGARLSEAE 180


>gi|330900904|gb|EGH32323.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330939472|gb|EGH42817.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330980590|gb|EGH78693.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 181

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F +++++K  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNAKAFQAATGLTREFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWDDADLAIDWQFDGQ--PNLSAKDQQGKRLKEAD 178


>gi|309789521|ref|ZP_07684104.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillochloris trichoides
           DG6]
 gi|308228487|gb|EFO82132.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Oscillochloris trichoides
           DG6]
          Length = 176

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 98/147 (66%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I+  ++FED+RG+F+ T+ +      GL    VQ N S++   GT+RG+HFQ  PYA+ K
Sbjct: 13  IIDLQRFEDNRGFFACTWEANEFAAQGLSTNVVQANLSYNRTKGTLRGMHFQHAPYAEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           L+RC+ G I D+ +D+R +S +Y  W+S+E+SA+N   +YIP GFAHGF TL  + EV+Y
Sbjct: 73  LIRCVRGAIVDVIIDLRPDSESYKRWISVELSADNRRALYIPEGFAHGFQTLVDDVEVMY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPL 154
           +V+ FY+     GV + D +  ITWPL
Sbjct: 133 QVSQFYTPSAADGVRYDDPAFGITWPL 159


>gi|313206230|ref|YP_004045407.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Riemerella anatipestifer DSM
           15868]
 gi|312445546|gb|ADQ81901.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Riemerella anatipestifer DSM
           15868]
          Length = 181

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 107/166 (64%), Gaps = 4/166 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           I++   FED RG+F + ++ K  ++L G+   FVQDN S S   G +RGLH Q+  +AQA
Sbjct: 13  IIEPTIFEDERGYFYEKFNEKKFEDLTGMNGHFVQDNISKS-SYGVLRGLHLQKGEHAQA 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLV C+ G+++D+AVD+R +SP++G W  +E++A N LQ Y+P GFAHGF  L       
Sbjct: 72  KLVSCLEGKVWDVAVDLREDSPSFGKWYGVELTAENKLQFYVPRGFAHGFAVLSEMAVFA 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPF 171
           YK  +FY+ E + G+ W D  + I W L +T +  +SEKD+  LPF
Sbjct: 132 YKCDNFYNKESEGGILWNDADLAIDWKLDETDVI-LSEKDKVQLPF 176


>gi|260436113|ref|ZP_05790083.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 8109]
 gi|260413987|gb|EEX07283.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. WH 8109]
          Length = 196

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 102/162 (62%), Gaps = 4/162 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  + F D RGWF ++++ +   E +G   +F QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LITPQAFGDDRGWFYESWNQRKFDEAVGESVLFSQDNHSRSVQ-GVLRGLHYQLAPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G I+D+AVDIRR+SPT+G WV +E+SA+N  Q++IP GFAHGF+TL    EV 
Sbjct: 78  KLVRATVGVIYDVAVDIRRHSPTFGTWVGVELSADNKCQLWIPEGFAHGFLTLSDVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKD 166
           YK   F++   +  + W D  + I WP+  L     S+S KD
Sbjct: 138 YKARGFWNKSCERAILWNDPDLAIAWPIDQLQGAEVSLSGKD 179


>gi|86147256|ref|ZP_01065571.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio sp. MED222]
 gi|85834971|gb|EAQ53114.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio sp. MED222]
          Length = 181

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 111/175 (63%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           I  V+I++   F D RG+F +T+S    ++L  G    FVQDNHS S   G +RGLH+Q 
Sbjct: 8   IRDVKIIEPSVFGDERGFFMETWSQDKFEKLVTGKATSFVQDNHSKS-KKGILRGLHYQ- 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR ++G +FD+AVDIR++SPT+G WV   +SA N  Q+++P GFAHGF    
Sbjct: 66  TQNTQGKLVRVVSGEVFDVAVDIRKDSPTFGQWVGELLSAENKRQLWVPEGFAHGFYVTS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              E +YK TD+Y+ E +  + W+D++++I WP+     P++SEKD     +N+I
Sbjct: 126 EEAEFVYKCTDYYNPEAEHCLFWKDETVNIKWPIESP--PTLSEKDSIGKRINEI 178


>gi|91215488|ref|ZP_01252459.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychroflexus torquis ATCC
           700755]
 gi|91186440|gb|EAS72812.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Psychroflexus torquis ATCC
           700755]
          Length = 182

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 107/174 (61%), Gaps = 7/174 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +N   I++ + FED RG F +T++SK   K  GL  VFVQDN S S   GTIRGLHFQ  
Sbjct: 8   LNDCFIIEPKVFEDERGSFFETFNSKDFKKNTGLNIVFVQDNQSIS-HYGTIRGLHFQEG 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            +AQAKL+R   G + D+ VD+R NS TY    S  +S  N  Q+++P GFAHGF +L  
Sbjct: 67  EFAQAKLIRVAKGEVLDVVVDMRPNSSTYLKQFSYLLSGENNHQLFVPRGFAHGFTSLSN 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLN 173
                YK  +FY+   +SG+ + DK+++I W  P  D I   VSEKDQNLP L+
Sbjct: 127 EVVFDYKCDNFYNKASESGIVFNDKALNIDWKIPKDDQI---VSEKDQNLPSLD 177


>gi|325131124|gb|EGC53845.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria meningitidis
           OX99.30304]
 gi|325137147|gb|EGC59742.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria meningitidis M0579]
 gi|325201266|gb|ADY96720.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria meningitidis
           M01-240149]
 gi|325207125|gb|ADZ02577.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria meningitidis
           NZ-05/33]
          Length = 179

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 4/164 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V++L+ + F D RG+F +T+  +  ++   +  FVQ+NHS S   G +RGLH+Q   
Sbjct: 8   IPDVKLLEPKVFGDERGFFMETFRDEWFRQNVAERTFVQENHSKSTQ-GVLRGLHYQ-TE 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR ++G +FD+AVD+RR+SPT+G WV   +SA+N  Q+++P GFAHGF  L   
Sbjct: 66  NTQGKLVRVVSGEVFDVAVDMRRDSPTFGHWVGEVLSADNKRQLWVPEGFAHGFYVLSDE 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            E +YK TD+Y+   +  + W D ++ I WPLL    PS+S KD
Sbjct: 126 AEFVYKCTDYYNPNAEHSLIWNDATVGIDWPLLGE--PSLSAKD 167


>gi|157961246|ref|YP_001501280.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella pealeana ATCC
           700345]
 gi|157846246|gb|ABV86745.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella pealeana ATCC
           700345]
          Length = 189

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 110/172 (63%), Gaps = 11/172 (6%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSK----LLKELGLQ-DVFVQDNHSFSFDCGTIRGL 56
           +I  V + + + F D+RG+F +T+       L  E+G+    FVQ+N S S     +RGL
Sbjct: 8   SIPDVLLFEPQVFGDARGFFMETFRQSEFEALFAEVGMVCPSFVQENMSRSAK-NVLRGL 66

Query: 57  HFQ--RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           H+Q  +P   Q KL+R  AG IFD+AVD+R+ S TYG W    +SA N LQ+YIP GFAH
Sbjct: 67  HYQTLQP---QGKLIRVTAGSIFDVAVDLRKGSKTYGQWFGQTLSAENRLQLYIPPGFAH 123

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           GF+TL  + ++IYK TD+Y+ EH+  +AW D  ++I WP+ + + P +SEKD
Sbjct: 124 GFLTLSDHADIIYKCTDYYAPEHERTIAWNDPQLNIQWPIGEGVKPILSEKD 175


>gi|308388300|gb|ADO30620.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis alpha710]
          Length = 180

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 4/164 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V++L+ + F D RG+F +T+  +  ++   +  FVQ+NHS S   G +RGLH+Q   
Sbjct: 9   IPDVKLLEPKVFGDERGFFMETFRDEWFRQNVAERTFVQENHSKSTQ-GVLRGLHYQ-TE 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR ++G +FD+AVD+RR+SPT+G WV   +SA+N  Q+++P GFAHGF  L   
Sbjct: 67  NTQGKLVRVVSGEVFDVAVDMRRDSPTFGHWVGEVLSADNKRQLWVPEGFAHGFYVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            E +YK TD+Y+   +  + W D ++ I WPLL    PS+S KD
Sbjct: 127 AEFVYKCTDYYNPNAEHSLIWNDATVGIDWPLLGE--PSLSAKD 168


>gi|302186966|ref|ZP_07263639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           syringae 642]
          Length = 181

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F +++++K  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNAKAFQAATGLTRDFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTFGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWDDADLAIDWQFDGQ--PSLSAKDQQGKRLKEAD 178


>gi|253567134|ref|ZP_04844585.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides sp. 3_2_5]
 gi|251944258|gb|EES84767.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Bacteroides sp. 3_2_5]
          Length = 192

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 109/182 (59%), Gaps = 6/182 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + IL+ R F+D RG+F ++++    +    Q  FVQDN S S   G IRGLHFQ+P
Sbjct: 7   SIEGLVILEPRLFQDDRGYFFESFNQGEFESNVCQTTFVQDNESKS-SYGVIRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR I G + D+AVDIR+ SPT+G  VS+E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVIKGAVLDVAVDIRKGSPTFGKHVSVELTEDNHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  +FY  E +  +AW D  ++I W  P    IL   S+KD +   L  +   F
Sbjct: 126 EVIFQYKCDNFYHPEAEGAIAWNDPDLNIDWRVPTRKVIL---SDKDTSHKCLGGVLDLF 182

Query: 180 EY 181
           +Y
Sbjct: 183 DY 184


>gi|313667388|ref|YP_004047672.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria lactamica ST-640]
 gi|313004850|emb|CBN86276.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria lactamica 020-06]
          Length = 185

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 98/161 (60%), Gaps = 4/161 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++LK + F+D RG+F +T+     KE      FVQ+NHS S   G +RGLH+Q     Q
Sbjct: 11  VKLLKPQVFKDGRGFFMETFRDGWFKENIADRTFVQENHSQS-RKGVLRGLHYQTE-NTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR IAG +FD+AVD+R  SPT+G W    +SA N  Q++IP GFAHGF  L    EV
Sbjct: 69  GKLVRAIAGEVFDVAVDMREGSPTFGKWAGATLSAQNQYQLWIPEGFAHGFYVLGDTAEV 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y  E +  + W D +I I WPL     P +S KD
Sbjct: 129 VYKCTDYYKPEAEQVLIWNDPAIGIGWPL--QTAPLLSPKD 167


>gi|293602507|ref|ZP_06684953.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Achromobacter piechaudii ATCC
           43553]
 gi|292819269|gb|EFF78304.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Achromobacter piechaudii ATCC
           43553]
          Length = 182

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 4/165 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V + + R F D RG+F ++++ K  +E  G++  FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPDVLVFEPRVFGDERGFFFESFNRKAFEEATGMRRDFVQDNHSRS-SKGVLRGLHYQ-I 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR   G +FD+AVDIR++SPTYG WV   +SA N  Q+++P GFAHGF+ +  
Sbjct: 66  QQTQGKLVRVSEGAVFDVAVDIRKSSPTYGQWVGTVLSAENKRQMWVPEGFAHGFLVISE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             E +YK TD+Y+ + +  ++W D SI I WP L +  P +SEKD
Sbjct: 126 YAEFLYKTTDYYAPQSERCISWDDPSIGIDWP-LGSDAPVMSEKD 169


>gi|253999154|ref|YP_003051217.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylovorus sp. SIP3-4]
 gi|253985833|gb|ACT50690.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylovorus sp. SIP3-4]
          Length = 181

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 111/170 (65%), Gaps = 8/170 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPY 63
           V I + + F D+RG+F ++Y+    + L GL   FVQDNHS S   G +RGLH+Q R P 
Sbjct: 11  VLIFEPKVFGDARGFFFESYNQNTFQALTGLSPNFVQDNHSASAK-GVLRGLHYQIRQP- 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR +AG + D+AVD+R++SP++G W S  +SA N  Q+++P GFAHGF+ L    
Sbjct: 69  -QGKLVRVVAGEVLDVAVDMRKSSPSFGRWTSAILSAENRRQMWVPEGFAHGFVVLSEFA 127

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPFL 172
           E +YK TDFY+ EH+  + W D +++I W L  T  P++S KD + L FL
Sbjct: 128 EFLYKTTDFYAPEHECCIRWDDPTLNIDWQL--TAPPALSAKDSRGLDFL 175


>gi|282877916|ref|ZP_06286725.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccalis ATCC
           35310]
 gi|281299917|gb|EFA92277.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccalis ATCC
           35310]
          Length = 182

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 113/167 (67%), Gaps = 6/167 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I++ + FED+RG+F + +  +   K++G  D F+QDN S S   G +RGLH+Q+
Sbjct: 7   KIKGVWIIEPKVFEDARGYFFEAWKQADFQKQIGQVD-FIQDNESKS-SFGVLRGLHYQK 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             Y+QAKLVR I GR+ D+AVD+R++SPT+  +VS+E+S +N  Q++IP GFAHGF+ L 
Sbjct: 65  GEYSQAKLVRVIKGRVLDVAVDLRKSSPTFSQYVSVELSEDNKRQLFIPRGFAHGFLVLS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKD 166
                 YKV + Y+   ++G+ W D++I+I+WP+  D I+   SEKD
Sbjct: 125 DEAIFTYKVDNPYAPAQEAGIRWDDETINISWPIDKDKIV--TSEKD 169


>gi|304310335|ref|YP_003809933.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium HdN1]
 gi|301796068|emb|CBL44272.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium HdN1]
          Length = 181

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 113/174 (64%), Gaps = 5/174 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ R F DSRG+F ++Y++   +EL GL   FVQDNHS S   G +RGLH+Q     
Sbjct: 11  VLILEPRVFGDSRGFFYESYNAARFRELTGLTVDFVQDNHSRS-GRGVLRGLHYQ-VQQP 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G ++D+AVD+RR+SP++G WV +E+S  N  +++IP GFAHGF+ L  + +
Sbjct: 69  QGKLVRVVRGSVWDVAVDVRRSSPSFGRWVGVELSEENQKEMWIPPGFAHGFVVLSESAD 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP 178
            +YK TD+Y+ +H+  + W D+ + + W  +    P +SEKD+    L + + P
Sbjct: 129 FLYKTTDYYAPQHERCIVWDDRDLGVNW--MYEGDPILSEKDKAGASLKEAELP 180


>gi|152993302|ref|YP_001359023.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurovum sp. NBC37-1]
 gi|151425163|dbj|BAF72666.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfurovum sp. NBC37-1]
          Length = 191

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 118/182 (64%), Gaps = 3/182 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           M I+ V +++ +  +D RG+F +T+   KL   LG +  F QDN S S   G +RGLH+Q
Sbjct: 6   MEISDVIVIEPKIHKDERGYFIETFRVDKLESFLGYKIDFCQDNESKS-SKGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
            PP+AQ KLVR + GR+ DIAVDIR+ SPT+G  V++E+S  N  Q+ +P GFAH F+ L
Sbjct: 65  LPPFAQTKLVRVVVGRVLDIAVDIRKGSPTFGKHVAVELSGENRKQLLVPRGFAHAFVVL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
           E NT   YKV  +YS E+D G+++ DK + I+WPL    L  +S +D + P L++ D  F
Sbjct: 125 EDNTIFAYKVDSYYSPEYDRGISYADKELAISWPLPSEEL-KLSTRDTSQPKLHETDEIF 183

Query: 180 EY 181
           EY
Sbjct: 184 EY 185


>gi|153214711|ref|ZP_01949556.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae 1587]
 gi|29725987|gb|AAO88920.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
 gi|124115147|gb|EAY33967.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae 1587]
          Length = 181

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 105/174 (60%), Gaps = 4/174 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGL--QDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T+  +  +EL       FVQDNHS S    T+RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWQQRKFEELVTCKPTQFVQDNHSKS-KKATLRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR I+G +FD+AVDIR++SPT+G WV + +SA N  Q++IP GFAHGF   
Sbjct: 66  TK-NAQGKLVRVISGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWIPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
               E +YK TD+Y+   +  + W D  I + WPL       +SEKD   P L+
Sbjct: 125 SDEAEFVYKCTDYYNPNAEGTIVWSDPDIGVEWPLDQYTDLIISEKDSAAPLLS 178


>gi|311697176|gb|ADQ00048.1| dTDP-4-dehydrorhamnose 3,5-epimerase [marine bacterium HP15]
          Length = 181

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 103/167 (61%), Gaps = 4/167 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-R 60
            I  V++++ + F D RG+F +T++ K  +E G+   FVQDNHS S    T+RGLH+Q +
Sbjct: 7   KIPAVKLIEPKVFGDERGFFMETWNEKAFREAGIDATFVQDNHSRSVK-NTLRGLHYQIK 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  Q KLVR   G +FD+AVD+R +S T G WV   +S  N   +++P GFAHGF+   
Sbjct: 66  QP--QGKLVRVTRGEVFDVAVDLRSDSSTCGQWVGEYLSEKNNRMLWVPPGFAHGFLVTS 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
              +  YK TDFY+ E++  + WQD  + I WPL  ++ P +S KDQ
Sbjct: 124 DTADFQYKCTDFYAPEYERSIYWQDLQLRICWPLQKSLKPLISRKDQ 170


>gi|253996731|ref|YP_003048795.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylotenera mobilis JLW8]
 gi|253983410|gb|ACT48268.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylotenera mobilis JLW8]
          Length = 186

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 111/170 (65%), Gaps = 6/170 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V IL+ + + D RG+F ++++ +  ++L G++  FVQDNHS S     +RGLH+Q 
Sbjct: 7   TIPDVLILEPQVYGDERGFFFESFNQQKFEQLTGVKTQFVQDNHSKS-AANVLRGLHYQ- 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR +AG +FD+AVD+R++S T+G WV   +S++N  Q+++P GFAHGF+ L+
Sbjct: 65  ISQPQGKLVRVVAGEVFDVAVDLRKHSQTFGQWVGAILSSDNKRQMWVPEGFAHGFLVLK 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP---LLDTILPSVSEKDQ 167
            NTE +YK TD+Y+ +H+  + W D  I I WP   L    +P +S KDQ
Sbjct: 125 DNTEFLYKTTDYYAPQHERCIRWDDADIGIEWPTASLAAHAIPVLSAKDQ 174


>gi|113475072|ref|YP_721133.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Trichodesmium erythraeum
           IMS101]
 gi|110166120|gb|ABG50660.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Trichodesmium erythraeum
           IMS101]
          Length = 181

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 111/175 (63%), Gaps = 4/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V +++ + F D RG+F ++++ +   E  G+   FVQDNHS S   G +RGLH+Q  
Sbjct: 8   IPEVLLIEPKVFGDERGFFMESFNQRNFSEKTGVNLEFVQDNHSRS-SQGVLRGLHYQ-I 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
             AQ KL+R + G IFD+AVDIR+NSP +G WV   +SA N  Q+++P GFAHGF  +  
Sbjct: 66  QQAQGKLLRVVLGEIFDVAVDIRKNSPNFGKWVGYLLSAENKRQLWVPPGFAHGFFVVSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             +V+YK TD+Y+ E++  + W D  I I+WP ++ I   +S+KD++   L + D
Sbjct: 126 TADVLYKTTDYYAPEYERSILWNDSEIGISWP-INGIEVKLSQKDKDGTTLKEAD 179


>gi|308234493|ref|ZP_07665230.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Atopobium vaginae DSM 15829]
          Length = 198

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 107/178 (60%), Gaps = 10/178 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
            ++ + I+ T+ F D RG+F +TY      + G+   FVQDNHS S  C G +RGLHFQ 
Sbjct: 17  KVDGLFIINTKIFGDERGFFMETYKEPDFIQAGITTKFVQDNHSKS--CRGVLRGLHFQ- 73

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             + Q+KLVR + GR+FD+AVD+R++S TYG W  + +S +N  Q +IP GFAHGF+ L 
Sbjct: 74  IHHPQSKLVRVVKGRVFDVAVDLRKDSATYGQWEGVILSEDNHTQFFIPQGFAHGFLVLS 133

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTIL-PS---VSEKDQNLPFL 172
              E  YK  D Y    + G+ W D  I I WP L  DT   PS   +SEKD+  PFL
Sbjct: 134 DEAEFCYKCDDIYHPGDEGGIMWNDPDIAIEWPALSGDTAFDPSELILSEKDKTHPFL 191


>gi|298384767|ref|ZP_06994327.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 1_1_14]
 gi|298263046|gb|EFI05910.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 1_1_14]
          Length = 184

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 106/167 (63%), Gaps = 6/167 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVFIIEPRLFKDDRGYFFESFSQREFNEKVRKVNFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G +VS+E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YAQSKLVRVIKGAVLDVAVDIRKGSPTFGKYVSVELTEDNHRQFFIPRGFAHGFSVLTDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQ 167
               YK  +FY+ + +  +AW D  + I W  P  + +L   SEKD+
Sbjct: 127 VIFQYKCDNFYAPQSEGALAWDDPDLGIDWRVPANEIVL---SEKDK 170


>gi|225686245|ref|YP_002734217.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella melitensis ATCC
           23457]
 gi|256043333|ref|ZP_05446268.1| dTDP-4-dehydrorhamnose 3,5-epimerase / dTDP-4-dehydrorhamnose
           reductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111660|ref|ZP_05452650.1| dTDP-4-dehydrorhamnose 3,5-epimerase / dTDP-4-dehydrorhamnose
           reductase [Brucella melitensis bv. 3 str. Ether]
 gi|225642350|gb|ACO02263.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella melitensis ATCC
           23457]
 gi|326410597|gb|ADZ67661.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella melitensis M28]
 gi|326553889|gb|ADZ88528.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brucella melitensis M5-90]
          Length = 163

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 3/158 (1%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q  P+++ KLV C+ G
Sbjct: 9   KDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQG 68

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
            ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL  +  + Y ++  Y+
Sbjct: 69  IVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYA 128

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 129 PDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 163


>gi|225574462|ref|ZP_03783072.1| hypothetical protein RUMHYD_02537 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038312|gb|EEG48558.1| hypothetical protein RUMHYD_02537 [Blautia hydrogenotrophica DSM
           10507]
          Length = 194

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 99/166 (59%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  +R+++   F D RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ   
Sbjct: 22  IEGLRVIEPTVFGDDRGYFMETYNYNDFKEAGIDVEFVQDNQSSS-RKGVLRGLHFQ-IN 79

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y Q KLVR ++G +FD+AVD+R  S TYG W  + +SA N  Q +IP  FAHGF+ L  +
Sbjct: 80  YPQDKLVRVVSGEVFDVAVDLREGSATYGQWYGVVLSAENKKQFFIPKNFAHGFLVLSDH 139

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E  YK TDFY    + G+ W D  I I WP+ + +    SEKDQ 
Sbjct: 140 AEFTYKCTDFYHPNDEGGLIWNDPDIGIQWPVPEGMELIFSEKDQK 185


>gi|17989175|ref|NP_541808.1| dTDP-4-dehydrorhamnose 3,5-epimerase / dTDP-4-dehydrorhamnose
           reductase [Brucella melitensis bv. 1 str. 16M]
 gi|260564541|ref|ZP_05835026.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 1 str.
           16M]
 gi|265989756|ref|ZP_06102313.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993136|ref|ZP_06105693.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 3 str.
           Ether]
 gi|16740537|gb|AAL27671.1| Bme22 [Brucella melitensis]
 gi|17985028|gb|AAL54072.1| dtdp-4-dehydrorhamnose 3,5-epimerase / dtdp-4-dehydrorhamnose
           reductase [Brucella melitensis bv. 1 str. 16M]
 gi|260152184|gb|EEW87277.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 1 str.
           16M]
 gi|262764006|gb|EEZ10038.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000425|gb|EEZ13115.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 184

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 3/158 (1%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q  P+++ KLV C+ G
Sbjct: 30  KDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQG 89

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
            ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL  +  + Y ++  Y+
Sbjct: 90  IVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYA 149

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 150 PDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 184


>gi|325261285|ref|ZP_08128023.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. D5]
 gi|324032739|gb|EGB94016.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium sp. D5]
          Length = 202

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (62%), Gaps = 2/152 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            IN + I++     DSRG+F +TY+ K ++E GL   FVQDN S S   G +RGLH+Q+ 
Sbjct: 12  GINGLCIIEPAVHGDSRGYFMETYNQKDMEEAGLGMNFVQDNQSSS-SKGVLRGLHYQKE 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR I G +FD+AVD+R  S TYG W  +E++ +N  Q YIP GFAHGF+ L  
Sbjct: 71  -FPQGKLVRVIKGNVFDVAVDLRSGSETYGKWFGVELTEDNKKQFYIPEGFAHGFLVLSD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWP 153
             E  YK TDFY    + G+AW D  I + WP
Sbjct: 130 VAEFCYKCTDFYHPGDEGGLAWNDPEIGVCWP 161


>gi|60681053|ref|YP_211197.1| putative dTDP-4-dehydrorhamnose 3,5 epimerase [Bacteroides fragilis
           NCTC 9343]
 gi|60492487|emb|CAH07257.1| putative dTDP-4-dehydrorhamnose 3,5 epimerase [Bacteroides fragilis
           NCTC 9343]
          Length = 191

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 106/167 (63%), Gaps = 6/167 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + I++ R F D RG+F ++++  +  E   + +FVQDN S S   G IRGLHFQ+P
Sbjct: 7   DIKGLVIIEPRLFRDERGYFFESFNQNVFIEKVCKTMFVQDNESKS-SYGVIRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D+AVDIR+ SPT+G  VS+E++ +N  Q +IP GFAHGF  L  
Sbjct: 66  PFAQSKLVRVVKGSVLDVAVDIRKGSPTFGKHVSVELTEDNHRQFFIPRGFAHGFSVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKD 166
                YK  +FY+ + +  +AW D  + I W  P+ + IL   SEKD
Sbjct: 126 EVVFQYKCDNFYAPQCEGAIAWNDPDLGIDWKIPMEEVIL---SEKD 169


>gi|265999143|ref|ZP_05465155.2| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 2 str.
           63/9]
 gi|263092407|gb|EEZ16660.1| dTDP-4-dehydrorhamnose reductase [Brucella melitensis bv. 2 str.
           63/9]
          Length = 184

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 3/158 (1%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           +D RGWF++ Y      E  L+  F Q + SFS + GT+RGLH+Q  P+++ KLV C+ G
Sbjct: 30  KDERGWFARVYCEAAFAERKLETHFPQHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQG 89

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
            ++D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL  +  + Y ++  Y+
Sbjct: 90  IVWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYA 149

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +H +G+ + D ++DI WP   ++   +S+KD   PFL
Sbjct: 150 PDHAAGIRYDDPALDIPWPEKPSV---ISQKDLGWPFL 184


>gi|330989098|gb|EGH87201.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 181

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQAATGLTREFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAINWQFDGQ--PNLSAKDQQGKRLKEAD 178


>gi|325970228|ref|YP_004246419.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta sp. Buddy]
 gi|324025466|gb|ADY12225.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Spirochaeta sp. Buddy]
          Length = 183

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 103/171 (60%), Gaps = 3/171 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V I++ R F D RG+F +TY+     + G+   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  DIEGVLIIEPRVFGDERGYFMETYNKADFYKAGITCEFVQDNQSKSRK-GVLRGLHFQKQ 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y QAKLVR   G ++D+AVD+R+ SPTYG +V   +SA    Q +IP GFAHGF+ L  
Sbjct: 69  -YPQAKLVRVTKGEVYDVAVDLRKESPTYGKYVGATLSAELKNQFFIPRGFAHGFLVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
             E  YK  +FY  E + G+ W D SI I WP +  I   +SEKD+ L  L
Sbjct: 128 EAEFTYKCDEFYHPEDEGGIRWDDPSIGIQWPEI-GIEYCLSEKDKALSTL 177


>gi|254468688|ref|ZP_05082094.1| dTDP-4-dehydrorhamnose 3,5-epimerase [beta proteobacterium KB13]
 gi|207087498|gb|EDZ64781.1| dTDP-4-dehydrorhamnose 3,5-epimerase [beta proteobacterium KB13]
          Length = 174

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 110/167 (65%), Gaps = 5/167 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V++++   FED RG+F ++++  +    +G +  FVQDN S S   G +RGLH+Q
Sbjct: 6   LKIPEVKLIEPDVFEDERGFFYESFNQHEFNNAIGQEISFVQDNQSKS-KKGVLRGLHYQ 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P++Q KLVR I+G++FD+AVDIR  S TYG WV+  ++  N  Q++IP GFAHGF++L
Sbjct: 65  KSPFSQGKLVRVISGQVFDVAVDIREGSETYGNWVAEVLTGENKKQLWIPEGFAHGFLSL 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           E +T   YKV+++YS  H+  +    K   ITWP LD +L   S+KD
Sbjct: 125 ENDTVFSYKVSNYYSSYHEVSINPFLKEFSITWPQLDYLL---SDKD 168


>gi|156304228|ref|XP_001617513.1| hypothetical protein NEMVEDRAFT_v1g226019 [Nematostella vectensis]
 gi|156194287|gb|EDO25413.1| predicted protein [Nematostella vectensis]
          Length = 194

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (59%), Gaps = 4/174 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           NI  V+I++   + D RG+F +T++ K  +E+  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   NIPDVKIIEPTVYGDERGFFMETWNQKQFEEMVTGKPTSFVQDNHSKSRK-GILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR I+G +FD+AVDIR +SPT+G WV   +SA N  Q+++P GFAHGF   
Sbjct: 66  TEN-TQGKLVRVISGEVFDVAVDIREDSPTFGKWVGEYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
             + E +YK TDFY+   +  + W D  + I WPL     P ++ KD N    N
Sbjct: 125 SEDAEFVYKCTDFYNPNAEHSIVWNDPDLAINWPLDVGGQPRLANKDLNGELFN 178


>gi|328944086|ref|ZP_08241551.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Atopobium vaginae DSM 15829]
 gi|327492055|gb|EGF23829.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Atopobium vaginae DSM 15829]
          Length = 212

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 107/178 (60%), Gaps = 10/178 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDC-GTIRGLHFQR 60
            ++ + I+ T+ F D RG+F +TY      + G+   FVQDNHS S  C G +RGLHFQ 
Sbjct: 31  KVDGLFIINTKIFGDERGFFMETYKEPDFIQAGITTKFVQDNHSKS--CRGVLRGLHFQ- 87

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             + Q+KLVR + GR+FD+AVD+R++S TYG W  + +S +N  Q +IP GFAHGF+ L 
Sbjct: 88  IHHPQSKLVRVVKGRVFDVAVDLRKDSATYGQWEGVILSEDNHTQFFIPQGFAHGFLVLS 147

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTIL-PS---VSEKDQNLPFL 172
              E  YK  D Y    + G+ W D  I I WP L  DT   PS   +SEKD+  PFL
Sbjct: 148 DEAEFCYKCDDIYHPGDEGGIMWNDPDIAIEWPALSGDTAFDPSELILSEKDKTHPFL 205


>gi|253578777|ref|ZP_04856048.1| sugar biosynthesis protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849720|gb|EES77679.1| sugar biosynthesis protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 202

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 89/140 (63%), Gaps = 2/140 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D+RG+F +TY+ K +KE G+   FVQDN S S   G +RGLHFQ+  Y Q KLVR + G 
Sbjct: 26  DARGYFMETYNEKDMKEAGIDIHFVQDNQSMSTK-GVLRGLHFQKQ-YPQCKLVRAVRGT 83

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R NS TYG W  + +SA N  Q  IP GFAHGF+ L    E  YKV DF+  
Sbjct: 84  VFDVAVDLRSNSETYGKWYGVTLSAENKKQFLIPEGFAHGFLVLSDEAEFCYKVNDFWHP 143

Query: 136 EHDSGVAWQDKSIDITWPLL 155
             + G+AW D  I I WP L
Sbjct: 144 NDEGGMAWNDPEIGIEWPEL 163


>gi|218259907|ref|ZP_03475432.1| hypothetical protein PRABACTJOHN_01093 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224852|gb|EEC97502.1| hypothetical protein PRABACTJOHN_01093 [Parabacteroides johnsonii
           DSM 18315]
          Length = 185

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (61%), Gaps = 1/180 (0%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I++ + F+D+RG+F + +     +E   +  FVQDN S S   G +RGLH+Q  
Sbjct: 7   EIPGVWIIEPKVFKDARGYFMEAWKKAEFEEHIGKVEFVQDNESCS-SKGVLRGLHYQLA 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY+Q+KLVR I G + D+AVD+R+ SPT+G +V++E+S  N  Q +IP GFAHGF  L  
Sbjct: 66  PYSQSKLVRVIKGCVLDVAVDLRKGSPTFGKYVAVELSDENKRQFFIPQGFAHGFHVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
                YKV + Y+  H+ G+ + D  + + W ++D  + ++S+KD+N P L   +  F+Y
Sbjct: 126 EAVFTYKVDNPYTPTHERGLRFDDPVVGVDWKIMDLSILNLSDKDRNAPLLQDAEINFKY 185


>gi|294788794|ref|ZP_06754035.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Simonsiella muelleri ATCC
           29453]
 gi|294483276|gb|EFG30962.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Simonsiella muelleri ATCC
           29453]
          Length = 180

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 104/165 (63%), Gaps = 4/165 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           NI  V++L+ + F D RG+F +T+     +E      FVQ+NHS S +   +RGLH+Q  
Sbjct: 7   NIPEVKLLEPKIFGDERGFFMETFRDNWFREHISDCTFVQENHSKS-NKNVLRGLHYQ-T 64

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR + G +FD+AVD+R++SPT+G W    +SA N  Q++IP GFAHGF TLE 
Sbjct: 65  AHTQGKLVRVVIGSVFDVAVDLRKSSPTFGKWFGTVLSAENKRQLWIPEGFAHGFYTLEN 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           NTE +YK TD+Y    +  + W D +I I W L+    P++S KD
Sbjct: 125 NTEFVYKCTDYYDPSSEHSLLWNDPTIGIEWNLIGE--PNLSAKD 167


>gi|329897709|ref|ZP_08272187.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium
           IMCC3088]
 gi|328921056|gb|EGG28468.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium
           IMCC3088]
          Length = 185

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (62%), Gaps = 6/171 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ R F D RG+F +TYS++  K  G+ + FVQDNHS S   G +RGLHFQ   Y Q
Sbjct: 11  VLIIEPRVFGDDRGFFLETYSAERYKTAGIPE-FVQDNHSRS-SKGVLRGLHFQLN-YPQ 67

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR ++G +FD+AVDIR  SPT+G    +E+SA N  Q Y+P GFAHGF+   +  + 
Sbjct: 68  GKLVRVVSGSVFDVAVDIRVGSPTFGKAAWVELSAENKRQFYVPPGFAHGFVVTSVTADF 127

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            YK TD+Y  E +  + W D +++I WP+    +P +S KD +   L  I+
Sbjct: 128 EYKCTDYYHPEDEGALLWSDAALNIPWPI---DIPQLSAKDASAKRLADIN 175


>gi|187927734|ref|YP_001898221.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia pickettii 12J]
 gi|187724624|gb|ACD25789.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia pickettii 12J]
          Length = 184

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 3/150 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + + DSRG+F ++++ +  + L G+   FVQDNHS S   G +RG+H+Q   +A
Sbjct: 13  VLILEPKVYGDSRGFFFESFNGREFETLTGVSTPFVQDNHSMS-RKGVLRGMHYQIE-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR I+G +FD+AVD+R++S T+G W  + +SA N  Q+++P GFAHGF+ L    E
Sbjct: 71  QGKLVRVISGEVFDVAVDLRKSSSTFGKWAGVRLSAENKRQLWVPPGFAHGFLVLSETAE 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            +YK TD++  EH+  V W D +I I WPL
Sbjct: 131 FLYKTTDYWYPEHERSVVWNDPTIAIDWPL 160


>gi|82701401|ref|YP_410967.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nitrosospira multiformis ATCC
           25196]
 gi|82409466|gb|ABB73575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nitrosospira multiformis ATCC
           25196]
          Length = 183

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 109/170 (64%), Gaps = 7/170 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +I  V I++ + F DSRG+F ++++ +  ++  GL   FVQDNHS S   G +RGLH+Q 
Sbjct: 7   SIPEVMIIEPKVFGDSRGFFFESFNQENFRQATGLDVRFVQDNHSRSVK-GVLRGLHYQV 65

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            RP   Q KLVR + G +FD+AVDIRR+SPT+G WV +E++ +N  Q+++P GFAHGF  
Sbjct: 66  RRP---QGKLVRVVRGAVFDVAVDIRRSSPTFGHWVGVELTEDNYRQLWLPPGFAHGFYV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L    + +YK T++Y  + D  + W D  I I WP+   + P VS KD+ 
Sbjct: 123 LSDIADFLYKTTEYYFSDFDRSILWNDPGIAIGWPIEAGVSPVVSSKDEK 172


>gi|88860050|ref|ZP_01134689.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Pseudoalteromonas
           tunicata D2]
 gi|88818044|gb|EAR27860.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Pseudoalteromonas
           tunicata D2]
          Length = 181

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/164 (42%), Positives = 99/164 (60%), Gaps = 2/164 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I+  + F D RG+F +T+     K       FVQ+NHS S   G +RGLH+Q   
Sbjct: 8   IADVKIIVPKIFGDERGYFMETFRDDWFKREVADVDFVQENHSSS-KQGILRGLHYQ-TE 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KL+R   G IFD+ VD+RR S T+G W    ++A N  Q+++P GFAHGF  +  +
Sbjct: 66  HAQGKLIRVTQGEIFDVVVDLRRQSSTFGQWFGCYLNAENKHQLWVPAGFAHGFYVVSQS 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            E+IYK TD+Y+  H+  + W D  + I WPLL   LP++S KD
Sbjct: 126 AEIIYKCTDYYAPAHEHSICWNDTDLAIDWPLLKGTLPTLSLKD 169


>gi|304314129|ref|YP_003849276.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermobacter
           marburgensis str. Marburg]
 gi|302587588|gb|ADL57963.1| predicted dTDP-4-dehydrorhamnose 3,5-epimerase [Methanothermobacter
           marburgensis str. Marburg]
          Length = 185

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 104/165 (63%), Gaps = 10/165 (6%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPPYAQ 65
           I++   + D RG+F +T++  L ++ GL   FVQDN S S   G +RGLHFQ  RP   Q
Sbjct: 16  IIEPEVYGDERGYFMETFNQALFRDHGLDITFVQDNESMS-RRGVLRGLHFQLKRP---Q 71

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KL+R + G IFD+AVD+RR+S TYG WV + +S  N  + +IP GFAHGF+ L     V
Sbjct: 72  GKLIRAVKGEIFDVAVDLRRDSETYGEWVGVHLSEENRREFFIPEGFAHGFLALADECIV 131

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWP--LLDTILPSVSEKDQN 168
            YK T+ Y  E+DSG+ W D  I I WP  L+D ++  +S+KD N
Sbjct: 132 NYKCTELYLPEYDSGIPWDDPDIGIEWPLELVDELI--ISDKDMN 174


>gi|293115726|ref|ZP_05792782.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Butyrivibrio crossotus DSM
           2876]
 gi|292808617|gb|EFF67822.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Butyrivibrio crossotus DSM
           2876]
          Length = 195

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 102/166 (61%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  +++++ R F D RG+F ++Y+    KE G+  VFVQDN S S   G +RGLHFQ+  
Sbjct: 21  IEGLKVIEPRVFGDERGYFFESYNYNDFKEAGIPQVFVQDNQSAS-KRGVLRGLHFQKN- 78

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G +FD+AVD+R+ S TYG W  + +S +N  Q +IP  FAHGF+ L   
Sbjct: 79  FPQDKLVRVIRGEVFDVAVDLRKGSKTYGKWFGVVLSEDNKKQFFIPKNFAHGFLVLSDY 138

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E  YK TDFY  + + G+ + D  I + WP  + +   +S+KDQ 
Sbjct: 139 AEFAYKCTDFYHPDDEGGLLYNDPDIGVEWPFEEGVELILSDKDQK 184


>gi|257462294|ref|ZP_05626710.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. D12]
 gi|317059963|ref|ZP_07924448.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. D12]
 gi|313685639|gb|EFS22474.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Fusobacterium sp. D12]
          Length = 191

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 104/163 (63%), Gaps = 7/163 (4%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           + DSRG+FS+ Y  K   ++G    FVQDN+S S   G +RGLHFQ+  + Q KL+R + 
Sbjct: 22  YPDSRGFFSEMYHKKEFVKMGFTKEFVQDNYSCS-KRGVLRGLHFQKK-HPQEKLLRVLK 79

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           GRI D+ +D+R  S ++G + S+E+SA N   +YIP G AHGF++LE +T+V YK TDFY
Sbjct: 80  GRILDVVLDLRMGSESFGKYFSVELSAENQKMLYIPAGMAHGFLSLEEDTQVFYKCTDFY 139

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPS----VSEKD-QNLPF 171
             E ++G+ W D+ + I W L    L      +SEKD QN+ F
Sbjct: 140 HPEEEAGILWNDRELAIDWKLEAYHLSEENLCLSEKDKQNMTF 182


>gi|51246075|ref|YP_065959.1| dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Desulfotalea
           psychrophila LSv54]
 gi|50877112|emb|CAG36952.1| probable dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase [Desulfotalea
           psychrophila LSv54]
          Length = 184

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 103/165 (62%), Gaps = 5/165 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++ R F D+RG+F +T+  K   EL     FVQ+NHS S   G +RGLH+Q     Q K
Sbjct: 13  IIEPRVFADARGFFMETWQQKKFDELIGPQTFVQENHSKS-SAGILRGLHYQEK-NTQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR + G +FD+AVDIR++S T+G WV + +SA N  Q +IP GFAHGF  +    + +Y
Sbjct: 71  LVRIVIGEVFDVAVDIRKDSNTFGQWVGVLLSAENKRQFWIPKGFAHGFYVISQEADFVY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
           K TD+Y+ + +  + W D  + I WPL     P +SEKDQ+ +PF
Sbjct: 131 KCTDYYNPQAERTILWNDPDLAIDWPL--KTPPQLSEKDQSGMPF 173


>gi|71733249|ref|YP_272458.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483684|ref|ZP_05637725.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626550|ref|ZP_06459504.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649196|ref|ZP_06480539.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|71553802|gb|AAZ33013.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320326581|gb|EFW82631.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331097|gb|EFW87069.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869503|gb|EGH04212.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330871968|gb|EGH06117.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330892261|gb|EGH24922.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv. mori
           str. 301020]
 gi|331012162|gb|EGH92218.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 181

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  +   GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQAATGLTREFVQDNHSRS-QQGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G++ D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       P++S KDQ    L + D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGQ--PNLSAKDQQGKRLKEAD 178


>gi|322433405|ref|YP_004210622.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX9]
 gi|321165794|gb|ADW71495.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidobacterium sp. MP5ACTX9]
          Length = 200

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 2/176 (1%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++L+ +++ D RGWFS+ ++ K    LGL + FVQ+N S+S   G +RGLH+Q     Q
Sbjct: 24  VKLLRPKQYPDERGWFSEVFTGKGFSALGLPEHFVQENQSYS-SRGVLRGLHYQLGK-QQ 81

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR ++G I+D+AVD+R  SP +G W   E++ +    ++IP GF HGF+    +  V
Sbjct: 82  GKLVRVLSGTIWDVAVDLRPGSPDFGQWAGFELTGDELELLWIPEGFGHGFLVTSESANV 141

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
           +YK T +Y    +  + W D S+ I WPL    +P++S KD    +++Q + P  Y
Sbjct: 142 LYKTTGYYYPAGERCIRWDDPSLKIDWPLEGLGVPNISAKDATGSYMSQAELPPAY 197


>gi|91782044|ref|YP_557250.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia xenovorans
           LB400]
 gi|91685998|gb|ABE29198.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia xenovorans
           LB400]
          Length = 183

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 108/167 (64%), Gaps = 7/167 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I  V IL+ + F D RG+F ++++++  +EL G++  FVQDNHS S     +RGLH+Q 
Sbjct: 9   EIPDVLILEPKVFGDDRGFFYESFNARRFEELTGVKREFVQDNHSRS-ARNVLRGLHYQI 67

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR + G +FD+AVD+R+ SPT+G WV + +SA N  Q+++P GFAHGF+  
Sbjct: 68  QNP--QGKLVRVVTGEVFDVAVDLRKQSPTFGRWVGVTLSAENKRQLWVPEGFAHGFVVT 125

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E +YK TD++  EH+  + W D  I I WP++    P++S KD
Sbjct: 126 SEYAEFLYKTTDYWYAEHERSIVWNDPQIGIQWPIVGQ--PALSGKD 170


>gi|288926984|ref|ZP_06420879.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccae D17]
 gi|315608741|ref|ZP_07883719.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccae ATCC 33574]
 gi|288336230|gb|EFC74616.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccae D17]
 gi|315249591|gb|EFU29602.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella buccae ATCC 33574]
          Length = 182

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 104/172 (60%), Gaps = 2/172 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+  + FED RG+F + +     +E   +  F+QDN S S   G +RGLH+Q  
Sbjct: 7   EIKGVWIMTPKVFEDRRGYFFEAWKKAEFEEHVGKVDFIQDNESKS-SFGVLRGLHYQTG 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            YAQAKLVR I GR+ D+AVD+R++SPT+G  V++E+S  N  Q +IP GFAHGF+ L  
Sbjct: 66  DYAQAKLVRVIKGRVLDVAVDLRKSSPTFGRHVAVELSEENKRQFFIPRGFAHGFLVLSE 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
                YKV + Y+ +H++G+ W D+ + I WP +D      S+KD   P L 
Sbjct: 126 EAVFTYKVDNAYAPQHEAGIRWDDEQVAIKWP-IDPGDVVTSDKDLKAPALK 176


>gi|153010710|ref|YP_001371924.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum anthropi ATCC
           49188]
 gi|151562598|gb|ABS16095.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ochrobactrum anthropi ATCC
           49188]
          Length = 174

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 107/172 (62%), Gaps = 3/172 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           +NI+    ++  + ED RGWF++ Y      E  ++  F Q + SFS + GT+RGLH+Q 
Sbjct: 6   LNIDGAWSIEPERLEDERGWFARVYCEAAFAERQMETHFPQHSLSFSREEGTLRGLHYQN 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P+++ KLV C+ G I+D+ VD+R +SPTY  W  +E+SA NG+Q+YIP G AHGF TL 
Sbjct: 66  EPHSETKLVTCLQGVIWDVLVDLRPHSPTYRRWAGVELSAENGVQLYIPEGCAHGFQTLT 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
            +  V Y ++  Y+ ++ +G+ + D S+ I WP   ++   +S+KD   P L
Sbjct: 126 SDVLVRYMISKPYAPDYATGLRYDDPSLGIPWPNRPSV---ISDKDLAWPLL 174


>gi|224369618|ref|YP_002603782.1| RfbC1 [Desulfobacterium autotrophicum HRM2]
 gi|223692335|gb|ACN15618.1| RfbC1 [Desulfobacterium autotrophicum HRM2]
          Length = 182

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++I  V ++  + F D RG+F +T+     KE      FVQDNHS S     +RGLH+Q 
Sbjct: 6   LSIPEVVLITPQVFGDHRGFFMETFRDDEFKENVAHATFVQDNHSKS-TQNILRGLHYQI 64

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
             + Q KLVR I+G +FD+AVDIR++SP +G W    +SA N   ++IP GFAHGF  L 
Sbjct: 65  K-HPQGKLVRVISGEVFDVAVDIRKSSPFFGRWSGATLSAENKNMLWIPPGFAHGFYVLS 123

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
              E  YK TD+Y+ EH+  + W D SI I WP++   +P +S+KD+
Sbjct: 124 NEAEFTYKCTDYYAPEHERSIRWDDPSIAIDWPIIHGTVPILSQKDK 170


>gi|221201086|ref|ZP_03574126.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2M]
 gi|221206462|ref|ZP_03579475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2]
 gi|221173771|gb|EEE06205.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2]
 gi|221178936|gb|EEE11343.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2M]
          Length = 183

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 3/150 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++ +   E     V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGYFYESFNGREFAEQVEPGVEFVQDNHSRSAK-GVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR+SP +G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRSSPNFGKWVGVTLSADNHRQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            +YK TD++  EH+  +AW D  I I WP+
Sbjct: 131 FLYKTTDYWYPEHERSIAWNDPDIGIEWPI 160


>gi|118580534|ref|YP_901784.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pelobacter propionicus DSM
           2379]
 gi|118503244|gb|ABK99726.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pelobacter propionicus DSM
           2379]
          Length = 181

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 109/172 (63%), Gaps = 9/172 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +I  V I++ + F D RG+F ++++ ++ +EL GL   FVQ NHS S   G +RGLH+Q 
Sbjct: 7   SIPDVLIVEPKVFGDERGFFFESFNQRIWRELTGLDGCFVQHNHSRS-TAGVLRGLHYQI 65

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
             P   Q KLVR ++G +FD+AVDIRR+S T+G W    +SA+N  Q+++P GFAHGF  
Sbjct: 66  HNP---QGKLVRVVSGEVFDVAVDIRRSSATFGRWFGAALSADNKRQLWVPPGFAHGFYV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
                E +Y  TDF++ EH+  +AW D  + I WPL     PS+S+KD+  P
Sbjct: 123 TSPVAEFLYLTTDFWAPEHERCIAWNDPDLAIQWPLAGE--PSLSDKDRAAP 172


>gi|313683244|ref|YP_004060982.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Sulfuricurvum kujiense DSM
           16994]
 gi|313156104|gb|ADR34782.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfuricurvum kujiense DSM
           16994]
          Length = 197

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 106/176 (60%), Gaps = 3/176 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTY-SSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V ++  +   D RG+F +T+ + KL   LG    F QDN S S   G +RGLH+Q 
Sbjct: 7   EIPDVIVIDPKVHGDERGYFVETFRADKLEAFLGFTIPFCQDNESKS-SYGVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
           PP+AQ+KLVR I G + D+AVDIR+ SPT+G  VS+ +S  N  Q++IP GFAHGF+ L 
Sbjct: 66  PPHAQSKLVRVIDGEVLDVAVDIRKGSPTFGRHVSVRLSGENKRQLFIPRGFAHGFVVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
                 YKV ++YS E D G+A+ D SI I W +  + L  +S KD   P LN  D
Sbjct: 126 ETCTFAYKVDNYYSPECDRGIAFDDPSIGIDWHVNHSDL-QLSPKDTEQPLLNAAD 180


>gi|309378566|emb|CBX22838.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 185

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 97/161 (60%), Gaps = 4/161 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V+ILK + F D RG+F +T+     KE      FVQ+NHS S   G +RGLH+Q     Q
Sbjct: 11  VKILKPQVFTDGRGFFMETFRDGWFKENIADRTFVQENHSQS-RKGVLRGLHYQTE-NTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G +FD+AVD+R  SPT+G W    +SA N  Q++IP GFAHGF  L    EV
Sbjct: 69  GKLVRVVVGEVFDVAVDMREGSPTFGKWTGATLSAQNQYQLWIPEGFAHGFYVLSDTAEV 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y  E +  + W D +I I WPL  T  P +S KD
Sbjct: 129 VYKCTDYYKPEAEQVLIWNDPAIGIGWPLQTT--PLLSPKD 167


>gi|301632557|ref|XP_002945349.1| PREDICTED: dTDP-4-dehydrorhamnose 3,5-epimerase-like [Xenopus
           (Silurana) tropicalis]
          Length = 181

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 110/169 (65%), Gaps = 9/169 (5%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +L+ + F D+RG+F ++++ K  ++  G   VFVQDNHS S   G +RGLH+Q
Sbjct: 6   LTIPDVVLLEPKVFGDARGFFFESFNQKAFQQATGSDGVFVQDNHSRS-SRGVLRGLHYQ 64

Query: 60  --RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFM 117
             +P   Q KLVR   G ++D+AVD+R+++PT+G WV  E+S  N  Q+++P GFAHGF+
Sbjct: 65  IAQP---QGKLVRVARGSVWDVAVDLRKSAPTFGQWVGAELSEENQRQLWVPPGFAHGFV 121

Query: 118 TLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            L  + + +YK TD+Y+ +H+  +AW D  + I WP   T  PS+S KD
Sbjct: 122 VLSDSADFLYKTTDYYAPQHERCIAWNDAQLAIQWPYAGT--PSLSAKD 168


>gi|282881317|ref|ZP_06289997.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella timonensis CRIS
           5C-B1]
 gi|281304793|gb|EFA96873.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella timonensis CRIS
           5C-B1]
          Length = 184

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 106/166 (63%), Gaps = 2/166 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ + F D+RG+F + +          +  F+QDN S S   G +RGLH+Q+  
Sbjct: 8   IQGVWIIEPKVFNDARGYFFEAWKQAEFNAHIGEVNFIQDNESQS-SYGVLRGLHYQKGA 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+QAKLVR I G + D+AVD+R++SPT+G  V++E+SA+N  Q++IP GFAHGF+ L   
Sbjct: 67  YSQAKLVRVIQGSVLDVAVDLRKSSPTFGKHVAVELSADNKRQLFIPRGFAHGFLVLSQE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
               YKV + Y+ +H++G+ W D+ ++I WP LD      SEKD N
Sbjct: 127 AIFTYKVDNVYAPQHEAGIRWNDEDLNIQWP-LDPACFITSEKDLN 171


>gi|153826358|ref|ZP_01979025.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae MZO-2]
 gi|149739927|gb|EDM54114.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae MZO-2]
          Length = 181

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 107/167 (64%), Gaps = 4/167 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E +YK TD+Y+ + +  + W D SI+I WP  + +L S  +K+
Sbjct: 125 SDEAEFVYKCTDYYNPKAEHSLLWNDPSINIEWPRSEGLLLSDKDKE 171


>gi|150008449|ref|YP_001303192.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parabacteroides distasonis
           ATCC 8503]
 gi|255014199|ref|ZP_05286325.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_7]
 gi|256841550|ref|ZP_05547057.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parabacteroides sp. D13]
 gi|301309339|ref|ZP_07215281.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
 gi|149936873|gb|ABR43570.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parabacteroides distasonis
           ATCC 8503]
 gi|256737393|gb|EEU50720.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Parabacteroides sp. D13]
 gi|300832428|gb|EFK63056.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 20_3]
          Length = 185

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ +  +D+RG+F + +     +E   +  FVQDN S S   G +RGLH+Q  P
Sbjct: 8   IPGVWIIEPKVLKDARGYFMEAFKQAEFEEHIGKIQFVQDNESCS-SKGVLRGLHYQLAP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q+KLVR I GR+ D+AVD+R  SPT+G +V++E+S  N  Q++IP GFAHGF  L   
Sbjct: 67  YSQSKLVRVIKGRVLDVAVDVREGSPTFGKYVAVELSDENKRQLFIPQGFAHGFHVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YKV + Y+  H+ G+ + D ++ + W + D    ++SEKD   P L   +  F+Y
Sbjct: 127 AIFTYKVDNPYTPTHERGIRYDDPTVHVDWSITDPESINLSEKDTKAPLLKDAELNFKY 185


>gi|330966030|gb|EGH66290.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 181

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 106/172 (61%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V IL+ + F D RG+F ++++++  ++  GL   FVQDNHS S   G +RGLH+Q    A
Sbjct: 11  VLILEPKVFGDERGFFYESFNARAFQQATGLTRQFVQDNHSRS-QRGVLRGLHYQ-IENA 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR   G + D+AVDIRR+SP +G WV +E+SA N  Q+++P GFAHGF+ L  + E
Sbjct: 69  QGKLVRVTVGTVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGFVVLSEHAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  +AW D  + I W       PS+S KDQ    L   D
Sbjct: 129 FLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGE--PSLSAKDQQGKSLKDAD 178


>gi|296136994|ref|YP_003644236.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thiomonas intermedia K12]
 gi|295797116|gb|ADG31906.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thiomonas intermedia K12]
          Length = 187

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 108/178 (60%), Gaps = 11/178 (6%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLK-ELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPP 62
           V IL+ + F D RG+F ++Y+ K    + GL   FVQDNHS S   G +RGLH+Q  +P 
Sbjct: 11  VLILEPKVFGDERGFFFESYNRKTFALDTGLDVEFVQDNHSKSAQ-GVLRGLHYQLVKP- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR + G ++D+AVD+RR+SP +  WV +E+SA N   +++P GF HGF+ L   
Sbjct: 69  --QGKLVRAVTGTVWDVAVDLRRSSPRFKQWVGVELSAQNQRLLWVPPGFGHGFVVLSET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL----PSVSEKDQNLPFLNQID 176
            + +YK TD++  EHD  +AW D  + I WPL    L    PS++ KD   P L Q +
Sbjct: 127 ADFLYKTTDYWYPEHDRNLAWNDPELAIAWPLKGLHLPGGQPSLAAKDAAAPRLAQAE 184


>gi|153854428|ref|ZP_01995706.1| hypothetical protein DORLON_01701 [Dorea longicatena DSM 13814]
 gi|149752954|gb|EDM62885.1| hypothetical protein DORLON_01701 [Dorea longicatena DSM 13814]
          Length = 202

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 98/168 (58%), Gaps = 18/168 (10%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D+RG+F +TY+ K ++E GL   FVQDN S S   G +RGLHFQ+  + Q KLVR + G 
Sbjct: 26  DARGYFMETYNQKDMEEAGLTMQFVQDNQSCSTK-GVLRGLHFQKE-FPQGKLVRVVKGS 83

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R +S TYG W  +E++  N  Q YIP GFAHGF+ L    E  YK TDFY  
Sbjct: 84  VFDVAVDLRSDSETYGKWFGVELTEENKKQFYIPEGFAHGFLVLSDIAEFCYKCTDFYHP 143

Query: 136 EHDSGVAWQDKSIDITWPLL----------------DTILPSVSEKDQ 167
             + G+AW D  I I WP L                D    ++SEKDQ
Sbjct: 144 GDEGGLAWNDPEIGIEWPTLTGEYKGTASGEGYALEDGTALNLSEKDQ 191


>gi|257093452|ref|YP_003167093.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045976|gb|ACV35164.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 180

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 6/163 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPYA 64
           V I++ + F D+RG+F +T++ +   +LGL   FVQDNHS S   G +RGLH+Q   P  
Sbjct: 11  VWIVEPKVFGDARGFFMETWNRRTFADLGLDVEFVQDNHSRSRQ-GVLRGLHYQIHEP-- 67

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  +G +FD+AVD+RR+SP +G W  + +S  N   +++P GFAHGF+ +    +
Sbjct: 68  QGKLVRVTSGEVFDVAVDLRRSSPHFGRWAGVTLSGENQRMLWVPPGFAHGFLVVSPAAD 127

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            +YK T +Y+ EH+  VAW D  I I WPL D   P++S KD+
Sbjct: 128 FLYKTTAYYAPEHERCVAWNDPDIGIRWPLDDE--PALSAKDR 168


>gi|167563827|ref|ZP_02356743.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia oklahomensis
           EO147]
          Length = 183

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 109/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   EL    V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKAFGDARGFFFESFNAREFAELVEPGVEFVQDNHSRS-ARGVLRGLHYQ-IQHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVD+R++SP +G WV + +SA N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDVRKSSPNFGKWVGVNLSAENKRQLWVPAGFAHGFVVLSETAD 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  E +  + W DK I I WP+     P V+ KD     L + +
Sbjct: 131 FLYKTTDYWYPEFERSILWSDKQIGIDWPMDRE--PLVAAKDAAGKLLGEAE 180


>gi|78188492|ref|YP_378830.1| dTDP-4-dehydrorhamnose 3,5-epimerase related [Chlorobium
           chlorochromatii CaD3]
 gi|78170691|gb|ABB27787.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium chlorochromatii
           CaD3]
          Length = 197

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 110/184 (59%), Gaps = 7/184 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V +L+ + F D RG+F +++   +++E   Q  FVQDN S S   G +RGLHFQ+P
Sbjct: 7   TIPEVLMLEPKVFGDERGYFFESFRQDVIEEHIGQVHFVQDNESKS-SYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           PY Q+KLVR + G++ D+AVD+R  SPT+G  ++  + +     +++P GFAHGF+ L  
Sbjct: 66  PYTQSKLVRALFGKVLDVAVDVRHGSPTFGQHITCLLDSERKNMLWVPKGFAHGFVVLSP 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPF 179
                YK  ++Y+  HD+G+AW D ++ I W  PL D  L   S KD   P L+ +D  F
Sbjct: 126 EAVFAYKCDNYYTPSHDAGIAWNDPALGIDWQLPLADVRL---SSKDAAQPSLSSVDC-F 181

Query: 180 EYDG 183
            YD 
Sbjct: 182 PYDA 185


>gi|315178427|gb|ADT85341.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio furnissii NCTC
           11218]
          Length = 183

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 108/166 (65%), Gaps = 4/166 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYS-SKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +N V +++   F D RG+F ++++ SK    +G+  +FVQDNHS S   G +RGLH+Q  
Sbjct: 9   LNDVFVIEMPVFGDERGFFMESFNQSKFNDAIGIPTIFVQDNHSKS-SQGVLRGLHYQVS 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR +AGR+FD+ +D+R++S T+G W   E+S +N  Q++IP GFAHGF++L  
Sbjct: 68  S-TQGKLVRVMAGRVFDVVLDLRKSSTTFGKWQGFELSGDNKKQLWIPEGFAHGFLSLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           N E +YK TD+Y+   +  + W D  + I WP ++ +   +SEKDQ
Sbjct: 127 NVEFVYKTTDYYNPNAERTIMWNDSELGIDWP-IEGLELVISEKDQ 171


>gi|29725992|gb|AAO88924.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
 gi|115279712|gb|ABI85328.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
          Length = 181

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 107/167 (64%), Gaps = 4/167 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E +YK TD+Y+ + +  + W D SI+I WP  + +L S  +K+
Sbjct: 125 SDEAEFVYKCTDYYNPKAEHSLLWNDPSINIEWPSSEGLLLSDKDKE 171


>gi|291615365|ref|YP_003525522.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585477|gb|ADE13135.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sideroxydans lithotrophicus
           ES-1]
          Length = 182

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (62%), Gaps = 6/172 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPYAQ 65
           I++ + F D RG+F ++++ +   EL G+ D FVQDNHS S     +RGLH+Q R P  Q
Sbjct: 13  IVEPKVFGDDRGFFYESFNQRRFTELTGVTDPFVQDNHSKSAR-NVLRGLHYQIRQP--Q 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR IAG + DIAVDIRR+S T+G WV + +SA N   +++P GFAHGF+ L  + E 
Sbjct: 70  GKLVRVIAGEVLDIAVDIRRSSATFGQWVGVNLSAENKKMLWVPKGFAHGFVVLSESAEF 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           +YK TD+++ EH+  +AW D  + I W L     P +S KDQ    L   ++
Sbjct: 130 LYKTTDYWAPEHERCIAWNDPDLAIDWQLAGAT-PLLSAKDQAGKLLRDAET 180


>gi|229512766|ref|ZP_04402234.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae TMA 21]
 gi|29726007|gb|AAO88936.1| dTDP-6-deoxy-D-glucose-3,5-epimerase [Vibrio cholerae]
 gi|229350276|gb|EEO15228.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio cholerae TMA 21]
          Length = 183

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 5/168 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TE-NTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVYLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
               E +YK TD+Y+   +  + W D  I I WPL  T  P +S KDQ
Sbjct: 125 SDEAEFVYKCTDYYNPTAEHSLLWNDPDIAIVWPLSGT-EPQLSVKDQ 171


>gi|260174674|ref|ZP_05761086.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
 gi|315922937|ref|ZP_07919177.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
 gi|313696812|gb|EFS33647.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. D2]
          Length = 189

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 112/181 (61%), Gaps = 4/181 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ R F+D RG+F +++S +   E   +  FVQDN S S   G +RGLHFQ+PP
Sbjct: 8   IEGVVIIEPRLFKDDRGYFFESFSQREFTEKVRKVDFVQDNESKS-SYGVLRGLHFQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           YAQ+KLVR I G + D+AVDIR+ SPT+G  VS+E++  N  Q +I  GFAHGF+ L   
Sbjct: 67  YAQSKLVRVIKGSVLDVAVDIRKGSPTFGEHVSVELTEENHRQFFISRGFAHGFVVLTEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YK  +FY+ + +  +AW D ++ I W +  D ++ SV  KDQ+   L +    F+Y
Sbjct: 127 VIFQYKCDNFYAPQCEGALAWDDPALKIDWKVPADKVILSV--KDQHHERLEEAGWLFDY 184

Query: 182 D 182
           +
Sbjct: 185 N 185


>gi|119775372|ref|YP_928112.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella amazonensis SB2B]
 gi|119767872|gb|ABM00443.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella amazonensis SB2B]
          Length = 176

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 101/171 (59%), Gaps = 4/171 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           IN V+++    FED RG+F +++  +   EL     FVQDN S S   GT+RGLH+Q   
Sbjct: 8   INEVKLIIPSVFEDERGYFFESWQQQRFAELVAPVTFVQDNQSLS-KRGTLRGLHWQEA- 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KL+  ++G IFD+AVDIR  SPTYG WV   +SA N  Q++IP GFAHGF  L  +
Sbjct: 66  HPQDKLISVLSGTIFDVAVDIRPESPTYGKWVGETLSAENHRQLFIPKGFAHGFYVLSES 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
             V YK +DFY  E +  + W D S+ I WP+    LP +S KD   P   
Sbjct: 126 AIVSYKCSDFYHPEDERSIRWDDPSLAIQWPIEG--LPLLSAKDAMAPLFT 174


>gi|163803299|ref|ZP_02197178.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio sp. AND4]
 gi|159172936|gb|EDP57774.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Vibrio sp. AND4]
          Length = 182

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 108/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQRPPY 63
           V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q    
Sbjct: 11  VKIIEPTVFGDERGFFMETWNQKQFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQTE-N 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR ++G +FD+AVDIR+ SPT+G WV   +S  N  Q+++P GFAHGF       
Sbjct: 69  TQGKLVRVVSGEVFDVAVDIRKGSPTFGQWVGEYLSGENKRQLWVPEGFAHGFYVTSDEA 128

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           E +YK TD+Y+   +  + W D++++I WP+ +T  P +S KD+   F +++
Sbjct: 129 EFVYKCTDYYNPSAEVSIQWDDEALNIDWPIAETT-PLLSGKDKGGIFFSKV 179


>gi|189347269|ref|YP_001943798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium limicola DSM 245]
 gi|189341416|gb|ACD90819.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Chlorobium limicola DSM 245]
          Length = 192

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 3/180 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ + F D RG+F +TY   +++    +  FVQDN S S   G +RGLH+Q+PP
Sbjct: 8   IPDVLIIEPKVFGDERGYFLETYRQDVIESRIGKVGFVQDNESKS-SYGVLRGLHYQKPP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q+KLVR ++G + DIAVD+R+ SP +G +V +E+SA     ++IP GFAHGF+ L   
Sbjct: 67  FTQSKLVRAVSGSVLDIAVDLRKGSPWFGKYVGVELSAERKNMLWIPKGFAHGFVVLSTE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
               YK  ++Y+ +HD+GV W D+ + I W + ++ +  VS+KD       ++D  F YD
Sbjct: 127 AVFAYKCDNYYAPDHDAGVLWNDRELAIDWQIPESDI-RVSDKDAKQQLFAEVDC-FIYD 184


>gi|148643368|ref|YP_001273881.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobrevibacter smithii
           ATCC 35061]
 gi|148552385|gb|ABQ87513.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanobrevibacter smithii
           ATCC 35061]
          Length = 185

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (58%), Gaps = 2/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   + D+RG+F +TY+    K+ G    FVQDN S SF  G +RGLH Q  
Sbjct: 10  DIEGMFVVEPAVYGDNRGYFMETYNENDFKKAGYDLTFVQDNQSQSFK-GVLRGLHLQLK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I G +FD+ VD+R +SPTYG W    +SA N  Q+YIP  FAHGF+ L  
Sbjct: 69  -YPQGKLVRVIKGEVFDVGVDLRADSPTYGKWHGEILSAENKKQLYIPPKFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T+FY  E + G+ W D  I + WPL      ++S+KD+    L +
Sbjct: 128 EAEFVYKCTEFYHGEDEGGIMWNDPDIAVEWPLEGIDEITLSDKDKKWKSLKE 180


>gi|222445611|ref|ZP_03608126.1| hypothetical protein METSMIALI_01251 [Methanobrevibacter smithii
           DSM 2375]
 gi|222435176|gb|EEE42341.1| hypothetical protein METSMIALI_01251 [Methanobrevibacter smithii
           DSM 2375]
          Length = 188

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (58%), Gaps = 2/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  + +++   + D+RG+F +TY+    K+ G    FVQDN S SF  G +RGLH Q  
Sbjct: 13  DIEGMFVVEPAVYGDNRGYFMETYNENDFKKAGYDLTFVQDNQSQSFK-GVLRGLHLQLK 71

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR I G +FD+ VD+R +SPTYG W    +SA N  Q+YIP  FAHGF+ L  
Sbjct: 72  -YPQGKLVRVIKGEVFDVGVDLRADSPTYGKWHGEILSAENKKQLYIPPKFAHGFVVLSD 130

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E +YK T+FY  E + G+ W D  I + WPL      ++S+KD+    L +
Sbjct: 131 EAEFVYKCTEFYHGEDEGGIMWNDPDIAVEWPLEGIDEITLSDKDKKWKSLKE 183


>gi|127512335|ref|YP_001093532.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella loihica PV-4]
 gi|126637630|gb|ABO23273.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella loihica PV-4]
          Length = 181

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 104/175 (59%), Gaps = 6/175 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
            I  V+I++   F D RG+F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   KIPDVKIIEPTVFGDERGFFMETWNQKRFEELVTGKHTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR I G +FD+AVDIR+ SPT+G WV   +SA N  Q+++P GFAHGF   
Sbjct: 66  TEN-TQGKLVRVIYGEVFDVAVDIRKGSPTFGKWVGEYLSAENNRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             + E +YK TD+Y+   +  + W DK + I WP      P +S KD N   +N+
Sbjct: 125 SEHAEFVYKCTDYYNPHMECSIQWDDKFLSIEWPFESE--PILSSKDSNCLGMNE 177


>gi|313159056|gb|EFR58431.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alistipes sp. HGB5]
          Length = 191

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 107/182 (58%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V IL+   F D+RG+F ++YS +          FVQDN S S   G +RGLHFQ+  
Sbjct: 8   IEGVVILEPEVFGDARGYFFESYSQRRFDAEVRPVRFVQDNESHS-RYGVLRGLHFQKGR 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q+KLVR + GR+ D+AVDIRR SPT+G  V++E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YSQSKLVRVVRGRVLDVAVDIRRGSPTFGRHVAVELTEDNKRQFFIPRGFAHGFAVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  + YS E +  +AW D S+ I W L   D IL   S KD   P L++    F+
Sbjct: 127 ATFQYKCDNPYSPESEGAIAWNDPSLGIDWRLAPEDVIL---SPKDSAHPLLSEAGELFD 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|170698773|ref|ZP_02889837.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria
           IOP40-10]
 gi|170136330|gb|EDT04594.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria
           IOP40-10]
          Length = 183

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 110/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V++++ + F D+RG+F ++++ +   E +G    FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKLIEPKVFGDARGYFYESFNGREFAEHIGPGIEFVQDNHSRSAK-GVLRGLHYQVQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR SPT+G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRRSPTFGKWVGVILSADNHRQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  EH+  + W D  I I WP+     P ++ KD     L++ +
Sbjct: 131 FLYKTTDYWYPEHERCIVWDDPEIGIEWPI--DAAPVLAPKDAAGKRLSEAE 180


>gi|294341170|emb|CAZ89571.1| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) (dTDP-L-rhamnose synthetase) [Thiomonas
           sp. 3As]
          Length = 187

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 108/178 (60%), Gaps = 11/178 (6%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLK-ELGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPP 62
           V IL+ + F D RG+F ++Y+ K    + GL   FVQDNHS S   G +RGLH+Q  +P 
Sbjct: 11  VLILEPKVFGDDRGFFFESYNRKTFALDTGLDVEFVQDNHSKSAQ-GVLRGLHYQLVKP- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR + G ++D+AVD+RR+SP +  WV +E+SA N   +++P GF HGF+ L   
Sbjct: 69  --QGKLVRAVTGTVWDVAVDLRRSSPRFKQWVGVELSAQNQRLLWVPPGFGHGFVVLSET 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL----PSVSEKDQNLPFLNQID 176
            + +YK TD++  EHD  +AW D  + I WPL    L    PS++ KD   P L Q +
Sbjct: 127 ADFLYKTTDYWYPEHDRNLAWNDPELAIAWPLKGLHLPGGQPSLAAKDAAAPRLAQAE 184


>gi|91774154|ref|YP_566846.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanococcoides burtonii DSM
           6242]
 gi|91713169|gb|ABE53096.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein
           [Methanococcoides burtonii DSM 6242]
          Length = 183

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 108/172 (62%), Gaps = 7/172 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  + ILK + F D RG+F ++Y++++L EL G +  FVQDN S S   G IRGLH+Q 
Sbjct: 7   KIEDLYILKPKVFGDERGYFFESYNARVLDELVGKKYNFVQDNESRS-SYGVIRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            PY+Q KLVR I G ++D+ VD+R+ S T+G WV +E+S +N  Q  IP GFAHGF  L 
Sbjct: 66  EPYSQTKLVRVIQGTVYDVVVDLRKESCTFGEWVGVELSEDNKKQFLIPKGFAHGFSVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLP 170
                 YK  D+Y+ E + G+ + D +++I W +   D I   V++KD+ LP
Sbjct: 126 ETAIFAYKCDDYYNPESEGGIMYDDPTLNIDWKVKKEDAI---VADKDKELP 174


>gi|213962325|ref|ZP_03390588.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sputigena
           Capno]
 gi|213954991|gb|EEB66310.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Capnocytophaga sputigena
           Capno]
          Length = 182

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 6/172 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++ + F D RG+F +++S +   E      FVQDN S S   G +RGLHFQ+PP+AQ
Sbjct: 11  VVIIEPQVFFDDRGYFFESFSQQRFNEQVAPITFVQDNESKS-SYGVLRGLHFQKPPFAQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
           +KLVR + G++ D+AVD+R+ SPT+G + S+ +S  N  Q +IP GFAHGF  L      
Sbjct: 70  SKLVRVVKGKVLDVAVDLRKGSPTFGQYESVVLSEENKRQFFIPQGFAHGFAVLSEEAIF 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQI 175
            YK  ++Y+ + +  V W D +I I W  P  D IL   S KD+  P L+Q+
Sbjct: 130 QYKCDNYYAPQSEGSVRWNDPTIAIDWQLPEKDIIL---SAKDEKAPLLSQL 178


>gi|117919830|ref|YP_869022.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sp. ANA-3]
 gi|117612162|gb|ABK47616.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Shewanella sp. ANA-3]
          Length = 183

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 5/169 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQRPPY 63
           V++++ + F D RG+F +T++ K  + L  G    FVQDNHS S   G +RGLH+Q    
Sbjct: 11  VKVIEPKVFGDERGFFMETWNQKQFENLVTGKSTTFVQDNHSKS-KRGILRGLHYQTKD- 68

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR I+G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAHGF  +    
Sbjct: 69  TQGKLVRVISGEVFDVAVDIRKDSPTFGQWVGEYLSAENKRQLWIPEGFAHGFYVISNEC 128

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
           E +YK T +Y+  ++  + W D ++ I WP+ +T    +S KD N +PF
Sbjct: 129 EFVYKCTKYYNPNYEKCLIWNDSNLQIDWPIPETERVLLSSKDSNGIPF 177


>gi|298376300|ref|ZP_06986256.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_19]
 gi|298267337|gb|EFI08994.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 3_1_19]
          Length = 185

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ +  +D+RG+F + +     +E   +  FVQDN S S   G +RGLH+Q  P
Sbjct: 8   IPGVWIIEPKVLKDARGYFMEAFKQAEFEEHIGKIEFVQDNESCS-SKGVLRGLHYQLAP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q+KLVR I GR+ D+AVDIR  SPT+G +V++E+S  N  Q++IP GFAHGF  L   
Sbjct: 67  YSQSKLVRVIKGRVLDVAVDIREGSPTFGKYVAVELSDENKRQLFIPQGFAHGFHVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YKV + Y+  H+ G+ + D ++ + W + D    ++SEKD   P L   +  F+Y
Sbjct: 127 AIFTYKVDNPYTPTHERGIRYDDPTVHVDWSITDPESINLSEKDTKAPSLKDAELNFKY 185


>gi|166031255|ref|ZP_02234084.1| hypothetical protein DORFOR_00942 [Dorea formicigenerans ATCC
           27755]
 gi|166029102|gb|EDR47859.1| hypothetical protein DORFOR_00942 [Dorea formicigenerans ATCC
           27755]
          Length = 226

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D+RG+F +TY+ K ++E GL   FVQDN S S   G +RGLHFQ+  + Q KLVR + G 
Sbjct: 50  DARGYFMETYNQKDMEEAGLTMQFVQDNQSCSTK-GVLRGLHFQKE-FPQGKLVRVVKGS 107

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R +S TYG W  +E++  N  Q YIP GFAHGF+ L    E  YK TDFY  
Sbjct: 108 VFDVAVDLRSDSETYGKWFGVELTEENKKQFYIPEGFAHGFLVLSEIAEFCYKCTDFYHP 167

Query: 136 EHDSGVAWQDKSIDITWPLL 155
             + G+AW D  I + WP L
Sbjct: 168 GDEGGLAWNDPEIGVEWPQL 187


>gi|163814426|ref|ZP_02205815.1| hypothetical protein COPEUT_00577 [Coprococcus eutactus ATCC 27759]
 gi|158450061|gb|EDP27056.1| hypothetical protein COPEUT_00577 [Coprococcus eutactus ATCC 27759]
          Length = 202

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 89/140 (63%), Gaps = 2/140 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D+RG+F +TY+ K +KE G+   FVQDN S S   G +RGLHFQ+  Y Q KLVR + G 
Sbjct: 26  DARGYFMETYNEKDMKEAGIDIHFVQDNQSMSTK-GVLRGLHFQKQ-YPQCKLVRAVRGT 83

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
           +FD+AVD+R +S TYG W  + +SA N  Q  IP GFAHGF+ L    E  YKV DF+  
Sbjct: 84  VFDVAVDLRSDSATYGKWYGVALSAENKKQFLIPEGFAHGFLVLSDEAEFCYKVNDFWHP 143

Query: 136 EHDSGVAWQDKSIDITWPLL 155
             + G+AW D  I I WP L
Sbjct: 144 NDEGGMAWNDPEIGIVWPKL 163


>gi|188994411|ref|YP_001928663.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Porphyromonas gingivalis ATCC
           33277]
 gi|47080240|dbj|BAD18849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Porphyromonas gingivalis]
 gi|188594091|dbj|BAG33066.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Porphyromonas gingivalis ATCC
           33277]
          Length = 196

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 111/171 (64%), Gaps = 8/171 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ R F D RG+F +++S + + E G++ + FVQDN S S   G +RGLHFQ+P
Sbjct: 8   IPEVVILEPRLFRDDRGYFFESFSRQEI-ETGIRPINFVQDNESAS-RYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D AVDIR  SPT+G +V++E+S  N  Q++IP GFAHGF+ L  
Sbjct: 66  PHAQSKLVRVVRGCVIDYAVDIRFGSPTFGKYVAVELSDTNFRQLFIPRGFAHGFVVLSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLP 170
                YK  ++Y+ + +  +AW D ++DI W  P+ D IL   S KDQ  P
Sbjct: 126 EVVFQYKCDNYYAPQSEGAIAWNDSNLDIDWKIPVEDIIL---SAKDQANP 173


>gi|318042943|ref|ZP_07974899.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. CB0101]
          Length = 205

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 6/150 (4%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLK---ELGLQDV--FVQDNHSFSFDCGTIRGLHFQRPP 62
           ++  R F D RG+F ++++ +      E   Q V  FVQDNHS S   G +RGLH+Q PP
Sbjct: 19  LITPRVFGDDRGFFFESWNQRAFAAALEADGQPVPEFVQDNHSRS-SQGVLRGLHYQLPP 77

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVRC+ G IFD+AVD+RR S ++G WV   +SA N  Q+++P GFAHGF TL  +
Sbjct: 78  HPQGKLVRCVLGEIFDVAVDLRRGSASFGQWVGARLSAANHQQLWVPAGFAHGFFTLSEH 137

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW 152
            EV+YK TDF+S + +  + W D  + I W
Sbjct: 138 AEVLYKTTDFWSRDCERAIRWDDPQLAIAW 167


>gi|84386939|ref|ZP_00989963.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio splendidus
           12B01]
 gi|84378229|gb|EAP95088.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Vibrio splendidus
           12B01]
          Length = 178

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 107/175 (61%), Gaps = 6/175 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           I  V+I++   F D RG F +T++ K  +EL  G    FVQDNHS S   G +RGLH+Q 
Sbjct: 8   IPDVKIIEPSVFGDERGLFMETWNQKQFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQT 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR ++G +FD+AVDIR+ SPT+G W+   +SA N  Q+++P GFAHGF    
Sbjct: 67  E-NTQGKLVRVVSGEVFDVAVDIRKGSPTFGQWIGEYLSAENKRQLWVPEGFAHGFYVTS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
              E +YK TD+Y+ + +  +AW D ++ I WPL  T  P +S+KD+      Q+
Sbjct: 126 DEAEFVYKCTDYYNPQAEISIAWDDDTLRIDWPL--TSPPRLSDKDRQGLLFEQL 178


>gi|189218516|ref|YP_001939157.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylacidiphilum infernorum
           V4]
 gi|189185374|gb|ACD82559.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylacidiphilum infernorum
           V4]
          Length = 181

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 102/167 (61%), Gaps = 3/167 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++   K ED RG+F++ +  +  +  GL     Q N S S   GT+RGLH+Q  P A+ K
Sbjct: 13  LIDLEKKEDPRGFFARVFCRREYEAHGLDPDIAQINTSLSLKKGTLRGLHYQVFPKAETK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           ++RC+ G ++D+ VD+R  S TY C    E++  N   +Y+P GFAHGF+TL  NTE  Y
Sbjct: 73  VIRCLRGALWDVIVDLRPESKTYLCHYGCELNEENRRMVYVPRGFAHGFLTLADNTEAYY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            V +FYS EH+ G+ + D +++ITWP    +   +SEKD+N P  N+
Sbjct: 133 LVGEFYSPEHERGIRYNDPALNITWPFEPLV---ISEKDRNYPDWNK 176


>gi|221134347|ref|ZP_03560652.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Glaciecola sp. HTCC2999]
          Length = 179

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 101/161 (62%), Gaps = 5/161 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I++   F D RG+F +T+ ++  +ELG+   FVQDN+S S   G +RGLHFQ+  Y Q
Sbjct: 11  VLIIEPAIFGDDRGFFKETFQAQRYRELGISQDFVQDNYSRS-SYGVLRGLHFQQQ-YPQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV C  G +FD+ VDI   S T+   VS+EIS  N  Q+YIP G+AHGF  L    + 
Sbjct: 69  GKLVSCTHGSVFDVIVDIDPGSATFTQHVSIEISGENHRQVYIPPGYAHGFCVLSDTADF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y  + ++G+ W D  IDI WP+   I P++S KD
Sbjct: 129 MYKCTDYYRPDDEAGILWNDPQIDIAWPI---IHPTLSPKD 166


>gi|300717500|ref|YP_003742303.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Erwinia billingiae Eb661]
 gi|299063336|emb|CAX60456.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Erwinia billingiae Eb661]
          Length = 181

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 104/166 (62%), Gaps = 5/166 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           ++  V I +   F D+RG+F +++S +   E +G    FVQDNHS S   G +RGLH+Q 
Sbjct: 7   SLTDVLIFEPTVFGDTRGFFFESFSQRFFDESVGRHVNFVQDNHSKSAK-GVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P AQ KLVRC+ G + DIAVDIR++S ++G WV + ++A N  Q++IP GFAHGF+TL 
Sbjct: 66  DPDAQGKLVRCVQGEVLDIAVDIRKSSSSFGKWVGVILNAENKRQLWIPEGFAHGFVTLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
              E +YK T++Y+   +  + W D  I I W   D +L   S+KD
Sbjct: 126 DTAEFVYKTTNYYAKNSERSILWNDPEIGIDWKTEDVLL---SDKD 168


>gi|15836862|ref|NP_297550.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa 9a5c]
 gi|9105072|gb|AAF83070.1|AE003879_5 dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa 9a5c]
          Length = 185

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 103/168 (61%), Gaps = 5/168 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ R F+D+RG F + ++++  +  G+   FVQ N S S   G +RGLH+Q P   Q K
Sbjct: 13  VIEPRVFDDARGEFFEAWNAECFQRQGMSSRFVQSNVSISM-YGVLRGLHYQWP-RPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV  + G ++D+AVDIRR SP YG WV++ +SA N  Q++IP GFAHGF+ L       Y
Sbjct: 71  LVGVLEGEVYDVAVDIRRGSPHYGRWVAVLLSAKNKRQLWIPEGFAHGFVVLSERAVFNY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             TD Y  E D+G+ W D  I + WP+    +P +S KDQ  PF+ ++
Sbjct: 131 LCTDVYVKEADAGIRWNDALIGVDWPI---AVPLLSAKDQKAPFMEEV 175


>gi|332532393|ref|ZP_08408273.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038260|gb|EGI74706.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 181

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  V+I++ + F D RG+F +T+ ++L  +   +  FVQ+NHS S   G +RGLH+Q  
Sbjct: 7   SIPDVKIIEPQVFGDERGFFMETFRTELFNQHCGERTFVQENHSKSAH-GILRGLHYQTQ 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR   G ++D+AVD+R++SPT+G WV + +SA N  Q+++P GFAHGF     
Sbjct: 66  -NTQGKLVRVTQGEVYDVAVDMRQSSPTFGQWVGVLLSAENKRQLWVPEGFAHGFYVTTE 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPFLN 173
             E +YK TD Y+   +  + W D +++I WPL++  LP +S KD+  L F N
Sbjct: 125 TAEFVYKCTDVYNPNVEVSIKWDDPTLNIDWPLVEGKLPQLSAKDEAGLSFKN 177


>gi|329118014|ref|ZP_08246727.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465902|gb|EGF12174.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 179

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 99/164 (60%), Gaps = 4/164 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+IL+ + F D RG+F +T+     K    +  FVQ+NHS S   G +RGLH+Q   
Sbjct: 8   IPEVKILEPQVFGDERGFFMETFRDDWFKAHVCERTFVQENHSQS-GGGVLRGLHYQ-TE 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR +AG +FD+AVD+RRNSPT+G W    +SA N  Q+++P GFAHGF  L   
Sbjct: 66  NTQGKLVRVVAGAVFDVAVDLRRNSPTFGQWAGAILSAENKRQLWVPEGFAHGFYVLGGG 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            E +YK TD+Y+   +  + W D +I I WPL     P +S KD
Sbjct: 126 AEFVYKCTDYYNPRAEHTLLWNDPAIGIAWPLHGE--PKLSAKD 167


>gi|294053939|ref|YP_003547597.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293613272|gb|ADE53427.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 178

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 104/158 (65%), Gaps = 3/158 (1%)

Query: 16  DSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGR 75
           D RG+F++TY ++ L+  G++   VQ N S+S   GT+RGLH Q+ P+ ++KL+R +AG 
Sbjct: 21  DDRGYFARTYCAQELEAHGIESRVVQSNTSYSRYAGTMRGLHMQQAPHEESKLMRAVAGS 80

Query: 76  IFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSV 135
             D+ VD+R  SPTY     +E+SA N   +Y+P GFAHGF+TL  +TE +Y V+++Y+ 
Sbjct: 81  FLDVMVDLRPQSPTYLQHYKIELSAQNRRMVYVPGGFAHGFLTLVDHTEALYMVSEYYTP 140

Query: 136 EHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
             ++GV + D ++ I WP+    +  VSEKD+  P L+
Sbjct: 141 GAETGVRYDDPALGIEWPI---PVREVSEKDRTWPLLS 175


>gi|72132992|gb|AAZ66345.1| RmlC [Listonella anguillarum]
          Length = 184

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 113/179 (63%), Gaps = 9/179 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           +I  V+I++   F D RG+F +T++ +  +EL  G    FVQDNHS S   G +RGLH+Q
Sbjct: 7   DIPDVKIIEPTVFGDERGFFMETWNQQRFEELVTGKPTQFVQDNHSKS-KKGILRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
                Q KLVR ++G +FD+AVDIR++SPT+G WV + +SA N  Q+++P GFAHGF   
Sbjct: 66  TEN-TQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVHLSAENKRQLWVPEGFAHGFYVT 124

Query: 120 EMNTEVIYKVTDFYS--VEHDS-GVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               E +YK T++Y+   EHD   + W D+SI+I WP  +   P +SEKD +   L+ I
Sbjct: 125 SEEAEFVYKCTNYYNPEAEHDEHTLLWNDESINIDWP--NKTCPLLSEKDVHGKHLSDI 181


>gi|190572701|ref|YP_001970546.1| putative DTDP-dehydrorhamnose 3,5-epimerase [Stenotrophomonas
           maltophilia K279a]
 gi|190010623|emb|CAQ44232.1| putative DTDP-dehydrorhamnose 3,5-epimerase [Stenotrophomonas
           maltophilia K279a]
          Length = 185

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 5/168 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++   F D+RG+F +T++++    LGL D FVQ N S S   G +RGLH+Q P   Q K
Sbjct: 13  VIEPAVFGDARGYFFETWNAERFAALGLPDRFVQSNVSTSAK-GVLRGLHYQWP-RPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV  + G ++D+AVDIRR SPT+G W ++ +SA N  Q +IP GFAHGF  L       Y
Sbjct: 71  LVSVLEGEVYDVAVDIRRGSPTFGQWEAVVLSAENKKQFWIPEGFAHGFAVLSERAVFSY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             T+ Y  + D+GV W D  I + WP+     P++S KD+N PFL  I
Sbjct: 131 LCTEVYLKDFDAGVRWNDADIAVDWPI---SAPTLSAKDENAPFLKDI 175


>gi|187251274|ref|YP_001875756.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Elusimicrobium minutum
           Pei191]
 gi|186971434|gb|ACC98419.1| DTDP-4-dehydrorhamnose 3,5-epimerase [Elusimicrobium minutum
           Pei191]
          Length = 185

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 104/167 (62%), Gaps = 6/167 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           ++  + F+D RG+F ++Y+ K+ ++ G+   FVQDN SFS     IRGLHFQ PP+AQAK
Sbjct: 13  VITPKIFKDERGYFFESYNKKVFEDAGIVSNFVQDNQSFSVK-NVIRGLHFQAPPHAQAK 71

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LVR   G+++D+AVD+R  S T+G W  +E+S  N    YIP GFAHGF  L  +    Y
Sbjct: 72  LVRAQRGKVWDVAVDLRPQSKTFGQWFGVELSEENQKMFYIPRGFAHGFSVLSESAVFQY 131

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFL 172
           K  +FY+ E + G+ + D  ++I W  P    I   V+EKD++ P+ 
Sbjct: 132 KCDNFYNKESEGGILYNDAVLNIDWKVPFGGEI---VNEKDKSYPWF 175


>gi|172036645|ref|YP_001803146.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. ATCC 51142]
 gi|171698099|gb|ACB51080.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Cyanothece sp. ATCC 51142]
          Length = 181

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 108/173 (62%), Gaps = 8/173 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I  V I++ R F D RG+F ++Y+ K   E  G++  FVQDNHS S     +RGLH+Q 
Sbjct: 7   KIPDVVIIEPRVFGDDRGFFYESYNQKAFTEATGIERNFVQDNHSRS-QKNVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR + G + D+AVDIR++SPT+G WVS  +S  N  Q ++P GFAHGF+ L
Sbjct: 66  QQP--QGKLVRVVVGEVLDVAVDIRKSSPTFGQWVSCLLSEENKRQFWVPEGFAHGFVVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN-LPF 171
               E +YK TD+Y+ +++  + W D  + I W L D   P +S+KDQ  LPF
Sbjct: 124 SDAAEFLYKTTDYYAPQYERSILWNDPDLAIDWQLKDE--PKLSKKDQEGLPF 174


>gi|116074424|ref|ZP_01471686.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RS9916]
 gi|116069729|gb|EAU75481.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. RS9916]
          Length = 195

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 104/164 (63%), Gaps = 4/164 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +++   F D RGWF ++++ +   + +G   VF QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LIQPSVFGDDRGWFFESWNQQRFDDAVGSPVVFSQDNHSRS-SRGVLRGLHYQLAPQPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G +FD+AVD+R+ SPT+G WV  E++A N  Q++IP GFAHGF+TL    EV 
Sbjct: 78  KLVRVSLGAVFDVAVDLRQKSPTFGHWVGAELTAENKAQLWIPEGFAHGFLTLSEVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQN 168
           YK   F++ + +  + W D S+ ITWP+  L     S+S+KD +
Sbjct: 138 YKARGFWNKDCERAIRWDDPSLAITWPVHQLKGTAVSLSDKDAD 181


>gi|53720294|ref|YP_109280.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Burkholderia pseudomallei
           K96243]
 gi|53725972|ref|YP_103575.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei ATCC
           23344]
 gi|124385294|ref|YP_001028707.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei NCTC
           10229]
 gi|126452584|ref|YP_001067377.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1106a]
 gi|134280426|ref|ZP_01767137.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           305]
 gi|167000834|ref|ZP_02266639.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei PRL-20]
 gi|167720870|ref|ZP_02404106.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           DM98]
 gi|167739852|ref|ZP_02412626.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei 14]
 gi|167817074|ref|ZP_02448754.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei 91]
 gi|167825484|ref|ZP_02456955.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei 9]
 gi|167846974|ref|ZP_02472482.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           B7210]
 gi|167895556|ref|ZP_02482958.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           7894]
 gi|167912205|ref|ZP_02499296.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           112]
 gi|167920166|ref|ZP_02507257.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           BCC215]
 gi|226193862|ref|ZP_03789464.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237813506|ref|YP_002897957.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           MSHR346]
 gi|238560979|ref|ZP_04609372.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei GB8 horse
           4]
 gi|242316360|ref|ZP_04815376.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1106b]
 gi|254175405|ref|ZP_04882065.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei ATCC
           10399]
 gi|254180916|ref|ZP_04887514.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1655]
 gi|254191761|ref|ZP_04898264.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254202265|ref|ZP_04908628.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei FMH]
 gi|254207598|ref|ZP_04913948.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei JHU]
 gi|254261524|ref|ZP_04952578.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1710a]
 gi|254298971|ref|ZP_04966421.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           406e]
 gi|254356500|ref|ZP_04972776.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei
           2002721280]
 gi|262193266|ref|YP_001081387.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei NCTC
           10247]
 gi|284159929|ref|YP_001060114.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           668]
 gi|3135676|gb|AAD05456.1| putative dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase [Burkholderia
           pseudomallei 1026b]
 gi|13518095|gb|AAK27393.1| putative dTDP-4-keto-6-deoxy-D-glucose [Burkholderia mallei]
 gi|52210708|emb|CAH36692.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Burkholderia pseudomallei
           K96243]
 gi|52429395|gb|AAU49988.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei ATCC
           23344]
 gi|124293314|gb|ABN02583.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei NCTC
           10229]
 gi|126226226|gb|ABN89766.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1106a]
 gi|134248433|gb|EBA48516.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           305]
 gi|147746512|gb|EDK53589.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei FMH]
 gi|147751492|gb|EDK58559.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei JHU]
 gi|148025497|gb|EDK83651.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei
           2002721280]
 gi|157809171|gb|EDO86341.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           406e]
 gi|157939432|gb|EDO95102.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696449|gb|EDP86419.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei ATCC
           10399]
 gi|184211455|gb|EDU08498.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1655]
 gi|225934167|gb|EEH30152.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506837|gb|ACQ99155.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           MSHR346]
 gi|238525295|gb|EEP88723.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei GB8 horse
           4]
 gi|242139599|gb|EES26001.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1106b]
 gi|243063264|gb|EES45450.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei PRL-20]
 gi|254220213|gb|EET09597.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           1710a]
 gi|261835086|gb|ABO07153.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia mallei NCTC
           10247]
 gi|283775101|gb|ABN83873.2| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           668]
          Length = 183

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 9/164 (5%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL---GLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           V+I++ + F D+RG+F ++++++   EL   G++  FVQDNHS S   G +RGLH+Q   
Sbjct: 13  VKIIEPKVFGDARGFFFESFNAREFTELVEPGIE--FVQDNHSRS-ARGVLRGLHYQ-IQ 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR + G +FD+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L  +
Sbjct: 69  HAQGKLVRVVDGEVFDVAVDVRRSSPNFGKWVGVRLSAENKRQLWVPAGFAHGFVVLSES 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            + +YK TD++  E +  + W DK I I WP+     P V+ KD
Sbjct: 129 ADFLYKTTDYWYPEFERSILWSDKQIGIEWPIDRE--PLVAAKD 170


>gi|67920202|ref|ZP_00513722.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Crocosphaera watsonii WH
           8501]
 gi|67857686|gb|EAM52925.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Crocosphaera watsonii WH
           8501]
          Length = 181

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 105/172 (61%), Gaps = 6/172 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
            I  V I++ R F D RG+F ++Y+ K   E  G+   FVQDNHS S +   +RGLH+Q 
Sbjct: 7   KIPDVVIIEPRIFGDDRGFFYESYNHKAFTEATGISRNFVQDNHSKS-ERNVLRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR + G + D+AVDIR++SPT+G WVS  +SA N  Q ++P GFAHGF+   
Sbjct: 66  QQ-TQGKLVRVVTGEVLDVAVDIRKSSPTFGQWVSCLLSAENKRQFWVPEGFAHGFVVSS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ-NLPF 171
              E +YK TD+Y+ EH+  + W D  + I W L     P +S+KDQ  LPF
Sbjct: 125 DAAEFLYKTTDYYAPEHERSILWNDPDLAIDWQLKGE--PKLSKKDQEGLPF 174


>gi|312131997|ref|YP_003999337.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Leadbetterella byssophila DSM
           17132]
 gi|311908543|gb|ADQ18984.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Leadbetterella byssophila DSM
           17132]
          Length = 177

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 100/159 (62%), Gaps = 5/159 (3%)

Query: 12  RKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRC 71
           R FED RG+F ++Y+ +L K  G+ + F+QDN SFS   G IRGLHFQR P+AQ KLVR 
Sbjct: 17  RIFEDDRGYFYESYNIELFKANGIPEEFLQDNQSFS-KKGVIRGLHFQRAPFAQGKLVRV 75

Query: 72  IAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
           I G + D+ VDIR  SPT+G + S  ++  N   +Y+P GFAHGF TLE +    YK T+
Sbjct: 76  IKGAVLDVVVDIRPESPTFGQYESFLLTEENKKMVYLPEGFAHGFSTLE-DAIFSYKCTN 134

Query: 132 FYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            Y    + G+ + D  ++I W + +   P VS+KD  LP
Sbjct: 135 VYHKASEGGIIYNDPDLNIDWQVSN---PVVSDKDLELP 170


>gi|193222278|emb|CAL61333.2| dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose
           3,5-epimerase) (dTDP-L-rhamnose synthetase)
           [Herminiimonas arsenicoxydans]
          Length = 181

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 110/170 (64%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           M I  V +++ + F D RG+F ++++  +    +G    FVQDNHS S   G +RGLH+Q
Sbjct: 6   MAIPDVLLIEPKVFGDDRGFFFESFNEQRFAAAVGKTVEFVQDNHSRSAR-GVLRGLHYQ 64

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR ++G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAHGF+ 
Sbjct: 65  IQQP--QGKLVRVVSGEVFDVAVDIRKSSPTFGLWVGALLSAENKRQMWIPEGFAHGFVV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
              + E +YK TD+++  H+  +AW D +I I WP+  +  P +S KDQN
Sbjct: 123 TSDSAEFLYKTTDYWAPGHERCIAWNDPAIGIEWPITGS--PILSGKDQN 170


>gi|257452250|ref|ZP_05617549.1| dTDP-4-dehydrorhamnose reductase [Fusobacterium sp. 3_1_5R]
 gi|317058793|ref|ZP_07923278.1| spore coat polysaccharide biosynthesis protein spsK [Fusobacterium
           sp. 3_1_5R]
 gi|313684469|gb|EFS21304.1| spore coat polysaccharide biosynthesis protein spsK [Fusobacterium
           sp. 3_1_5R]
          Length = 470

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 6/170 (3%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            +  V I+ T KFED RG+FS+ Y     KELG+QD F+Q+N S+S   GT+RGLHFQ  
Sbjct: 10  ELEGVYIIDTLKFEDERGYFSEIYQKDCFKELGIQDDFIQENISYSKK-GTLRGLHFQTK 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KL+R + G+I+D+ VD+R NS TYG  + +E+   +   ++IP G AHGF++L+ 
Sbjct: 69  K-KQGKLLRVLKGKIYDVIVDLRENSKTYGQHIGIELQGQDQKLLWIPPGCAHGFLSLDE 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLD-TILPS---VSEKDQ 167
              V Y+ T+ Y+ E++SG+ W D  ++I W L +  IL     +SEKD+
Sbjct: 128 KNVVQYQCTENYAAEYESGILWSDTDLNIDWKLKEYGILKEELIISEKDR 177


>gi|134094385|ref|YP_001099460.1| dTDP-4,deoxyrhamnose 3,5 epimerase [Herminiimonas arsenicoxydans]
          Length = 176

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 110/170 (64%), Gaps = 7/170 (4%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           M I  V +++ + F D RG+F ++++  +    +G    FVQDNHS S   G +RGLH+Q
Sbjct: 1   MAIPDVLLIEPKVFGDDRGFFFESFNEQRFAAAVGKTVEFVQDNHSRS-ARGVLRGLHYQ 59

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            + P  Q KLVR ++G +FD+AVDIR++SPT+G WV   +SA N  Q++IP GFAHGF+ 
Sbjct: 60  IQQP--QGKLVRVVSGEVFDVAVDIRKSSPTFGLWVGALLSAENKRQMWIPEGFAHGFVV 117

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
              + E +YK TD+++  H+  +AW D +I I WP+  +  P +S KDQN
Sbjct: 118 TSDSAEFLYKTTDYWAPGHERCIAWNDPAIGIEWPITGS--PILSGKDQN 165


>gi|78184213|ref|YP_376648.1| dTDP-4-dehydrorhamnose 3,5-epimerase related [Synechococcus sp.
           CC9902]
 gi|78168507|gb|ABB25604.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Synechococcus sp. CC9902]
          Length = 196

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 99/166 (59%), Gaps = 4/166 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  R F D RGWF ++++ K   E   Q V F QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LITPRAFGDDRGWFFESWNQKRFNEAVGQSVEFSQDNHSRSIQ-GVLRGLHYQLAPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR   G IFD+A+DIR+ SPT G WV   +SA N  Q++IP GFAHGF+TL    EV 
Sbjct: 78  KLVRSSVGSIFDVAIDIRQTSPTCGQWVGAVLSAENKAQLWIPEGFAHGFLTLSPVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLP 170
           YK   F++   +  + W D ++ I WP   L+    S+S+KD   P
Sbjct: 138 YKARGFWNKACERAIRWDDPNLAIDWPQAELNGTAISLSDKDAEAP 183


>gi|13541732|ref|NP_111420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermoplasma volcanium GSS1]
 gi|14325138|dbj|BAB60063.1| NDP-sugar epimerase [Thermoplasma volcanium GSS1]
          Length = 179

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (65%), Gaps = 8/157 (5%)

Query: 13  KFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCI 72
           ++ED+RG+F + Y +     + L   FVQDNHSFS   G IRGLHFQR P AQ KLV  I
Sbjct: 20  RYEDNRGYFEERYKASEFDRI-LHVRFVQDNHSFS-RRGVIRGLHFQREPMAQGKLVGVI 77

Query: 73  AGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDF 132
            GRI+D+AVD+R++S T+G WV   +S N  L  +IP GFAHGF  LE ++ V+YKV + 
Sbjct: 78  TGRIYDVAVDLRKDSVTFGKWVYRVLSNNEML--WIPRGFAHGFQALE-DSHVVYKVDNE 134

Query: 133 YSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNL 169
           +S +H+ G+ + D  + I WP+ D   P VSEKD  L
Sbjct: 135 FSRQHEDGIIFNDPDLAIDWPIKD---PIVSEKDIKL 168


>gi|269793219|ref|YP_003318123.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100854|gb|ACZ19841.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 186

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 105/172 (61%), Gaps = 7/172 (4%)

Query: 14  FEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIA 73
           F DSRG+F QT+ ++  ++ G+ + FVQDN S S   GT+RGLH+Q+P   Q KLV  + 
Sbjct: 19  FGDSRGYFLQTWQARQYRDAGISEFFVQDNLSLS-RKGTLRGLHYQKP-NTQGKLVFVLK 76

Query: 74  GRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFY 133
           G ++D+AVD+R  SPT+G W  + +      Q+YIP GFAHGF  +       YK TDFY
Sbjct: 77  GEVWDVAVDLRVGSPTFGKWEGVTLKGQTHNQLYIPPGFAHGFCVISDEALFTYKCTDFY 136

Query: 134 SVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI--DSPFEYDG 183
           + +++ G+ W D  +DI WP+ D IL   S KD   P L  I  +S F ++G
Sbjct: 137 APQNEHGIIWNDPDLDIPWPVKDPIL---SAKDGRYPRLRDIPGESLFRWEG 185


>gi|282898610|ref|ZP_06306598.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein
           [Cylindrospermopsis raciborskii CS-505]
 gi|281196478|gb|EFA71387.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein
           [Cylindrospermopsis raciborskii CS-505]
          Length = 181

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 110/170 (64%), Gaps = 9/170 (5%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I  V +++ + F D RG+F ++++ KL  E  G+   FVQDNHS S     +RGLH+Q 
Sbjct: 7   EIPDVLLIEPQVFGDERGFFYESFNEKLFTEKTGISPHFVQDNHSRS-GKNVLRGLHYQI 65

Query: 60  -RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
            +P   Q KLVR  AG +FDIAVD+R++SPT+  WV + +S+ N  Q++IP GFAHGF+ 
Sbjct: 66  QQP---QGKLVRVAAGEVFDIAVDLRKSSPTFSQWVGVYLSSANKHQLWIPPGFAHGFLV 122

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           L    + +YK TD+Y+ E+D G+ W D  + I+WP+ +   P VS KD++
Sbjct: 123 LSEYADFLYKTTDYYAPEYDRGILWNDPDLAISWPIGNE--PIVSSKDKS 170


>gi|325680882|ref|ZP_08160419.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus albus 8]
 gi|324107346|gb|EGC01625.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus albus 8]
          Length = 183

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 102/173 (58%), Gaps = 4/173 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+  + + D+RG+F +TY     K  GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  KIKGVYIIDVKTYGDNRGYFMETYKEADFKAAGLDYNFVQDNQSSS-RKGVLRGLHFQKT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + QAKLVR I G +FD+AVD+R+ S TYG WV + +S  N  Q  IP GFAHGF+ +  
Sbjct: 69  -HPQAKLVRVIKGEVFDVAVDLRKGSETYGQWVGVLLSEENHRQFMIPRGFAHGFVVVSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E  YK  D Y  E + G+ W D +I I W  +  ++  +SEKD++ P L +
Sbjct: 128 YAEFAYKCDDVYHPEDEGGIMWNDPAIGIEWADVGEVI--LSEKDKHHPSLAE 178


>gi|288800122|ref|ZP_06405581.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288333370|gb|EFC71849.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 181

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 105/162 (64%), Gaps = 1/162 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           +  V I++++ F D RG+F ++++SK   E      F+QDN S S   G +RGLH+Q+  
Sbjct: 8   LKGVWIIESKVFNDDRGYFFESWNSKSFTEHIGAINFIQDNESKS-SYGVLRGLHYQKGD 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQAKLVR I G + D+AVD+RR+SPT+G +V++E+S  N  Q++IP GFAHGF+ L   
Sbjct: 67  AAQAKLVRVIKGNVLDVAVDLRRSSPTFGKYVAVELSETNKRQLFIPRGFAHGFLVLSPE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSE 164
               YKV + Y+ E ++ + W D S+ I WP+ D ++ SV +
Sbjct: 127 AIFCYKVDNVYAPEKEATLMWNDDSVSINWPIKDGLIFSVKD 168


>gi|254416320|ref|ZP_05030074.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Microcoleus chthonoplastes
           PCC 7420]
 gi|196177002|gb|EDX72012.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Microcoleus chthonoplastes
           PCC 7420]
          Length = 181

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 9/165 (5%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQ--RPP 62
           V I++ R F D RG+F ++Y+ K   E   +   FVQDNHS S     +RGLH+Q  +P 
Sbjct: 11  VVIIEPRVFGDERGFFLESYNQKAFTEKANIAANFVQDNHSRSVK-NVLRGLHYQIQQP- 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR I G + D+AVDIR++SPT+G WVS  +SA N  QI+IP GFAHGF+ +   
Sbjct: 69  --QGKLVRAIVGTVLDVAVDIRQSSPTFGQWVSCLLSAENKRQIWIPPGFAHGFLVVSEV 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            EVIYK TD+Y+ +H+  + W D  + I W L  T  P +S KDQ
Sbjct: 127 AEVIYKTTDYYAPQHERTLLWNDPDLGIDWDL--TTEPILSAKDQ 169


>gi|262383284|ref|ZP_06076420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_33B]
 gi|262294182|gb|EEY82114.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacteroides sp. 2_1_33B]
          Length = 185

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ +  +D+RG+F + +     +E   +  FVQDN S S   G +RGLH+Q  P
Sbjct: 8   IPGVWIIEPKVLKDARGYFMEAFKQAEFEEHIGKIEFVQDNESCS-SKGVLRGLHYQLAP 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q+KLVR I GR+ D+AVD+R  SPT+G +V++E+S  N  Q++IP GFAHGF  L   
Sbjct: 67  YSQSKLVRVIKGRVLDVAVDVREGSPTFGKYVAVELSDENKRQLFIPQGFAHGFHVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
               YKV + Y+  H+ G+ + D ++ + W + D    ++SEKD   P L   +  F+Y
Sbjct: 127 AIFTYKVDNPYAPTHERGIRYDDPTVHVDWGITDPESINLSEKDTKAPSLKDAELNFKY 185


>gi|258653357|ref|YP_003202513.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nakamurella multipartita DSM
           44233]
 gi|258556582|gb|ACV79524.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nakamurella multipartita DSM
           44233]
          Length = 181

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 3/176 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V I++  +  D RG+F++++        GL    VQ N S++   GT+RG+HFQ  P
Sbjct: 8   IDGVAIVELEERRDDRGFFARSFCQDEFAAHGLLPEVVQCNLSYNHRAGTLRGMHFQLEP 67

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             +AKLVRCI+G I DI VD+R  SPTY   V++E+SA N    Y+P  FAHGF TL  N
Sbjct: 68  ATEAKLVRCISGAIVDIIVDLRPGSPTYRQHVAVELSAANRRSFYVPPMFAHGFQTLVDN 127

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSP 178
           TEV+Y+V++ Y+   + G+ + D ++ ++WPL    + ++S+KD + P L  + +P
Sbjct: 128 TEVLYQVSERYTPGQERGLRYDDPALGLSWPL---PVSAISDKDASWPLLEPVGAP 180


>gi|317055130|ref|YP_004103597.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus albus 7]
 gi|315447399|gb|ADU20963.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus albus 7]
          Length = 183

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 100/173 (57%), Gaps = 4/173 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V I+  + + D RG+F +TY     K  GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 10  KIKGVYIIDVKTYGDERGYFMETYKEDDFKAAGLDYKFVQDNQSSS-RKGVLRGLHFQKT 68

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + QAKLVR + G +FD+AVD+R+ S TYG WV   +S  N  Q  IP GFAHGF+ +  
Sbjct: 69  -HPQAKLVRVLKGEVFDVAVDLRKGSETYGQWVGAVLSEENKRQFMIPRGFAHGFLVMSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
             E  YK  D Y  E + G+ W D +I I W  +  ++  +SEKD++ P L +
Sbjct: 128 YAEFAYKCDDLYHPEDEGGIMWNDPAIGIEWKDVGELI--LSEKDKHHPSLAE 178


>gi|254195983|ref|ZP_04902408.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           S13]
 gi|169652727|gb|EDS85420.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia pseudomallei
           S13]
          Length = 215

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 9/164 (5%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL---GLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           V+I++ + F D+RG+F ++++++   EL   G++  FVQDNHS S   G +RGLH+Q   
Sbjct: 45  VKIIEPKVFGDARGFFFESFNAREFTELVEPGIE--FVQDNHSRS-ARGVLRGLHYQ-IQ 100

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQ KLVR + G +FD+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L  +
Sbjct: 101 HAQGKLVRVVDGEVFDVAVDVRRSSPNFGKWVGVRLSAENKRQLWVPAGFAHGFVVLSES 160

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            + +YK TD++  E +  + W DK I I WP+     P V+ KD
Sbjct: 161 ADFLYKTTDYWYPEFERSILWSDKQIGIEWPIDRE--PLVAAKD 202


>gi|34541218|ref|NP_905697.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Porphyromonas gingivalis W83]
 gi|34397534|gb|AAQ66596.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Porphyromonas gingivalis W83]
          Length = 196

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 110/171 (64%), Gaps = 8/171 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ R F D RG+F +++S + + E G++ + FVQDN S S   G +RGLHFQ+P
Sbjct: 8   IPEVVILEPRLFRDDRGYFFESFSRQEI-ETGIRPINFVQDNESAS-RYGVLRGLHFQKP 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+AQ+KLVR + G + D AVDIR  SPT+G +V++E+S  N  Q++IP GFAHGF+ L  
Sbjct: 66  PHAQSKLVRVVRGCVIDYAVDIRFGSPTFGKYVAVELSDTNFRQLFIPRGFAHGFVVLSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLP 170
                YK  ++Y+ + +  +AW D ++DI W  P  D IL   S KDQ  P
Sbjct: 126 EVVFQYKCDNYYAPQSEGAIAWNDPNLDIEWKIPAEDIIL---SAKDQANP 173


>gi|291566907|dbj|BAI89179.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Arthrospira platensis
           NIES-39]
          Length = 178

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 102/161 (63%), Gaps = 3/161 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           I++    +D RG+FS+++  K   E GL    VQ N SF+   GT+RG+H+Q  P+ +AK
Sbjct: 13  IVELEPIQDERGFFSRSWCQKEFAERGLTSNLVQCNISFNRHKGTLRGMHYQAKPHEEAK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           +VRC  G I+D+ +DIR +S T+  WV++E++A N   +YIP G AHGF TL  NTEV Y
Sbjct: 73  VVRCTMGAIYDVIIDIRPDSATFKQWVAVELTAENRKMLYIPEGMAHGFQTLTDNTEVFY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
           ++++FY  E   G+ W D    ITW   +   P +S+KD+N
Sbjct: 133 QMSEFYHPESARGLRWDDPRFGITWIHNN---PIMSDKDKN 170


>gi|282801708|gb|ADB02818.1| RmlC [Escherichia coli]
          Length = 180

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 4/166 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V+I+K    ED RG+F ++++ K+  E+  + +FVQDNHS S+  GT+RGLHFQ   
Sbjct: 8   IEDVKIIKPIIHEDERGFFMESWNQKVFNEVIGKTIFVQDNHSKSYK-GTLRGLHFQTSN 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR I G +FD+ VD+R  S T+G WV + +S+ N  Q++IP GFAHGF  +  +
Sbjct: 67  -PQGKLVRVINGEVFDVVVDLRHQSKTFGKWVGVYLSSVNNYQLWIPEGFAHGFYVVSDH 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
            E +YK TD+Y+      ++W D  + I WP LDT  P +SEKD++
Sbjct: 126 AEFVYKCTDYYNPYSQQTLSWDDPELGILWP-LDT-APILSEKDKS 169


>gi|241662193|ref|YP_002980553.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia pickettii 12D]
 gi|240864220|gb|ACS61881.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia pickettii 12D]
          Length = 183

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (60%), Gaps = 7/173 (4%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ-RPPY 63
           V IL+ + FED RG+F +++++K  +   G    FVQDNHS S     +RGLH+Q R P 
Sbjct: 13  VLILEPKVFEDQRGFFHESFNAKDFEAATGSSHAFVQDNHSRSLR-NVLRGLHYQVRQP- 70

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
            Q KLVR  AG +FD+AVDIR+ SP +G WV   +SA N  Q++IP GFAHGF+      
Sbjct: 71  -QGKLVRVTAGEVFDVAVDIRKKSPNFGRWVGAILSAENKRQLWIPEGFAHGFVVTSEQA 129

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           +++YK TD++  E++  +AW D  + I WP+   ++  VS KD     L   +
Sbjct: 130 DLLYKTTDYWHPEYERAIAWNDPQLGIAWPIQGEVI--VSAKDAAASLLENAE 180


>gi|172059823|ref|YP_001807475.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria
           MC40-6]
 gi|171992340|gb|ACB63259.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia ambifaria
           MC40-6]
          Length = 183

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 110/172 (63%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V++++ + F D+RG+F ++++ +   E +G    FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKLIEPKVFGDARGYFYESFNGREFAEHIGPGIEFVQDNHSRSAK-GVLRGLHYQVQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR+SP +G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRSSPDFGKWVGVTLSADNHRQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  EH+  + W D  I I WP+     P ++ KD     L++ +
Sbjct: 131 FLYKTTDYWYPEHERCIVWDDPEIGIEWPI--DAAPVLAPKDAAGKRLSEAE 180


>gi|71898670|ref|ZP_00680840.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa Ann-1]
 gi|71731617|gb|EAO33678.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa Ann-1]
          Length = 185

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 102/168 (60%), Gaps = 5/168 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ R F+D+RG F + ++++  +  G+   FVQ N S S   G +RGLH+Q P   Q K
Sbjct: 13  VIEPRVFDDARGEFFEAWNAECFERQGMSSRFVQSNVSISM-YGVLRGLHYQWP-RPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV  + G ++D+AVDIRR SP YG WV++ +SA N  Q++IP GFAHGF+ L       Y
Sbjct: 71  LVGVLEGEVYDVAVDIRRGSPHYGRWVAVLLSAKNKRQLWIPEGFAHGFVVLSERAVFNY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             TD Y  E D+G+ W D  I + WP+     P +S KDQ  PF+ ++
Sbjct: 131 LCTDVYVKEADAGIRWNDAVIGVDWPIA---APLLSAKDQKAPFMEEV 175


>gi|161525767|ref|YP_001580779.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans ATCC
           17616]
 gi|189349511|ref|YP_001945139.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans ATCC
           17616]
 gi|160343196|gb|ABX16282.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans ATCC
           17616]
 gi|189333533|dbj|BAG42603.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans ATCC
           17616]
          Length = 183

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (64%), Gaps = 5/162 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++ +   E     V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGYFYESFNGREFAEQVEPGVEFVQDNHSRSAK-GVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR+SP +G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRSSPNFGKWVGVTLSADNHRQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            +YK TD++  EH+  + W D  I I WP+     P ++ KD
Sbjct: 131 FLYKTTDYWYPEHERSIVWNDPDIGIEWPI--EFEPLLAAKD 170


>gi|3132257|dbj|BAA28134.1| dTDP-4-keto-6-deoxy-D-glucose-3,6-epimerase [Actinobacillus
           actinomycetemcomitans]
          Length = 180

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 4/165 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V++L+ + F D RG+F +T+  +  +E      FVQ+NHS S   G +RGLH+Q  
Sbjct: 7   KIPDVKLLELQVFGDERGFFMETFRDEWFRENVADHTFVQENHSKSIK-GVLRGLHYQTE 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G +FD+AVD+R+NSPT+G WV   +SA N  Q+++P GFAHGF  L  
Sbjct: 66  N-TQGKLVRVVSGAVFDVAVDMRKNSPTFGQWVGEILSAENKRQLWVPEGFAHGFYVLTD 124

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
             E  YK TD+Y+ + +  + W D+++ I WPL     PS+S KD
Sbjct: 125 EAEFTYKCTDYYNPKAEHSLIWNDETVGIEWPLEGE--PSLSAKD 167


>gi|119475336|ref|ZP_01615689.1| dTDP-4-dehydrorhamnose 3,5-epimerase [marine gamma proteobacterium
           HTCC2143]
 gi|119451539|gb|EAW32772.1| dTDP-4-dehydrorhamnose 3,5-epimerase [marine gamma proteobacterium
           HTCC2143]
          Length = 184

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 101/170 (59%), Gaps = 5/170 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V I +   F D RG+F +TY++   KE G+ + F+QDN SFS   G +RGLH+Q P   Q
Sbjct: 11  VIIFEPTVFGDDRGYFLETYNADRYKEAGISENFIQDNLSFS-RKGILRGLHYQTP-MEQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLV+ I G ++D+AVD+R  SPT+G W    +S +N  QIY+P GFAHGF+        
Sbjct: 69  GKLVQVIKGEVYDVAVDVRAGSPTFGHWYGSVLSESNKRQIYVPAGFAHGFVVTSDTALF 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            YK T+ Y+  ++  +AW D  + I WP+ D   P VSEKDQ    L  +
Sbjct: 129 SYKCTELYNPTNERRIAWNDTDLAINWPITD---PLVSEKDQQAVLLKDL 175


>gi|124486242|ref|YP_001030858.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanocorpusculum labreanum
           Z]
 gi|124363783|gb|ABN07591.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanocorpusculum labreanum
           Z]
          Length = 193

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 11/170 (6%)

Query: 8   ILKTRKFEDSRG----WFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPY 63
           I++T  F D RG    WF +   + +L +  +++V    N S +   G+IRG+HFQ+PP+
Sbjct: 16  IVETNAFIDHRGAFARWFCEEELAAVLGKRHIKNV----NFSRTVKKGSIRGMHFQKPPH 71

Query: 64  AQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNT 123
           A+ KLVRCI GRI D+ VDIR  SPT+    S+E+SA N     +P GFAHGF +LE ++
Sbjct: 72  AEMKLVRCIRGRILDVVVDIRAGSPTFLQHYSVELSAENMKMFAVPEGFAHGFQSLEDDS 131

Query: 124 EVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           E++Y VT+FYS E ++G+ + D ++ I WPL    +  +SEKD   P +N
Sbjct: 132 EIMYLVTEFYSPESEAGLRFSDPALKIEWPL---PVMDISEKDGKHPLVN 178


>gi|313157732|gb|EFR57143.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alistipes sp. HGB5]
          Length = 190

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 108/182 (59%), Gaps = 6/182 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I+ V IL+   F D+RG+F ++YS +          FVQDN S S   G +RGLHFQ+  
Sbjct: 8   IDGVVILEPEVFGDARGYFFESYSQRRFDAEVRPVRFVQDNESHS-RYGVLRGLHFQKGR 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+Q+KLVR + GR+ D+AVDIRR SPT+G  V++E++ +N  Q +IP GFAHGF  L   
Sbjct: 67  YSQSKLVRVVRGRVLDVAVDIRRGSPTFGRHVAVELTEDNKRQFFIPRGFAHGFAVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLL--DTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  + Y+ E +  +AW D S+ I W L   D +L   S KD   P L++    F+
Sbjct: 127 ATFQYKCDNPYAPESEGAIAWNDPSLGIDWRLAPEDVVL---SPKDSAHPLLSEAGELFD 183

Query: 181 YD 182
           Y+
Sbjct: 184 YN 185


>gi|320332782|ref|YP_004169493.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Deinococcus maricopensis DSM
           21211]
 gi|319754071|gb|ADV65828.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Deinococcus maricopensis DSM
           21211]
          Length = 185

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 97/159 (61%), Gaps = 3/159 (1%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           ED RG F++TY  +   E GL+    Q N SF+   GT+RG+HFQ PP+A+ KLVRC  G
Sbjct: 20  EDERGGFARTYCGREFAEHGLKVDVAQANLSFNHKAGTLRGMHFQLPPFAETKLVRCTRG 79

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
            I D+ VD+R +SPTY   V++E+SA N   +Y+P  FAHG+  L    EV+Y+V ++Y+
Sbjct: 80  AILDVIVDLRPDSPTYLQHVAVELSAENRRALYVPELFAHGYQALTDGAEVVYQVGEYYT 139

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
             H+ G+   D  + + WPL  T+   +S KD   P L 
Sbjct: 140 PGHERGLRHDDPRLGLQWPLPVTV---ISAKDAAWPLLT 175


>gi|307825026|ref|ZP_07655248.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacter tundripaludum
           SV96]
 gi|307734073|gb|EFO04928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methylobacter tundripaludum
           SV96]
          Length = 181

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 110/176 (62%), Gaps = 7/176 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQ-R 60
           I  V I++   F D RG+F ++++ +   EL   DV FVQDNHS S     +RGLH+Q R
Sbjct: 8   IPDVLIIEPNVFGDERGFFFESFNRRRFAELTGCDVDFVQDNHSRSVK-NVLRGLHYQIR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P  Q KLVR + G +FD+AVDIRR+SP++G  V LE+SA N   ++IP GFAHGF+ + 
Sbjct: 67  QP--QGKLVRVVQGAVFDVAVDIRRSSPSFGQSVGLELSAENKRMLWIPEGFAHGFVVIS 124

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              E +YK TD+++ E +  +AW D +I I WPL     P++S KDQ    L + +
Sbjct: 125 ETAEFLYKTTDYWAPEFERSIAWNDPAIGIQWPLQGE--PALSVKDQQATSLAEAE 178


>gi|59710775|ref|YP_203551.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Vibrio fischeri ES114]
 gi|59478876|gb|AAW84663.1| dTDP-4-deoxyrhamnose-3,5-epimerase [Vibrio fischeri ES114]
          Length = 185

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 111/171 (64%), Gaps = 6/171 (3%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           I+K + F D RG+F +T+ S+  KE+ G+++ FVQDN S S     +RGLHFQ+    Q 
Sbjct: 13  IIKPKVFGDERGFFLETFHSQRYKEVAGIKEQFVQDNRSQS-SKNVLRGLHFQKTK-PQG 70

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLV  I+G +FD+AVD+R  S T+G + ++ +S +N LQ Y+P GFAHGF  L  + +  
Sbjct: 71  KLVTVISGEVFDVAVDLRPESETFGQYEAVVLSGDNKLQFYVPPGFAHGFCVLSESADFQ 130

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
           YK TD+Y  + +SG+ W D  I+I WPL     P +SEKD+  P L++I++
Sbjct: 131 YKCTDYYDPDDESGLLWSDPIINIQWPLK---TPLLSEKDKIQPLLSEIEA 178


>gi|221200997|ref|ZP_03574037.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2M]
 gi|221206551|ref|ZP_03579564.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2]
 gi|221173860|gb|EEE06294.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2]
 gi|221178847|gb|EEE11254.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia multivorans
           CGD2M]
          Length = 183

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 100/150 (66%), Gaps = 3/150 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++ +   E     V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGYFYESFNGREFAEQVEPGVEFVQDNHSRSAK-GVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIRR+SP +G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRRSSPNFGKWVGVTLSADNHWQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            +YK TD++  EH+  + W D  I I WP+
Sbjct: 131 FLYKTTDYWYPEHERSIVWNDPDIGIEWPI 160


>gi|254281914|ref|ZP_04956882.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium
           NOR51-B]
 gi|219678117|gb|EED34466.1| dTDP-4-dehydrorhamnose 3,5-epimerase [gamma proteobacterium
           NOR51-B]
          Length = 183

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 106/173 (61%), Gaps = 2/173 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           ++ V +LK R F D RG+F + ++ +   + G+   FVQDNHS S   G +RGLHFQ   
Sbjct: 8   LSGVMLLKPRVFGDERGFFLEAWNQRTYADAGIDVHFVQDNHSRSRQ-GILRGLHFQTE- 65

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
             Q KLVR  +G +FD+ VD+R +SPT G W    +SA+N  Q++IP GFAHGF  L  +
Sbjct: 66  QTQGKLVRVTSGSVFDVVVDLRADSPTCGQWYGATLSASNHEQLWIPPGFAHGFYVLSES 125

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
            + +YK +D+Y  E +  +AW D S+ I WPL++   P +S KD     ++Q+
Sbjct: 126 ADFLYKCSDYYHPESELTLAWNDPSVGIEWPLVNDQPPQLSAKDATGLPIDQV 178


>gi|167580855|ref|ZP_02373729.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia thailandensis
           TXDOH]
          Length = 183

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 111/172 (64%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   EL    V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGFFFESFNAREFSELVEPGVEFVQDNHSRS-ARGVLRGLHYQ-IEHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L  + +
Sbjct: 71  QGKLVRVVDGEVFDVAVDVRRSSPNFGKWVGVRLSAENKRQLWVPAGFAHGFVVLSESAD 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  E +  + W D+ I I WP+     P V+ KD     L++ +
Sbjct: 131 FLYKTTDYWYPEFERSILWSDEQIGIEWPIDRE--PLVAAKDAAGKTLSEAE 180


>gi|28198138|ref|NP_778452.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa Temecula1]
 gi|182680768|ref|YP_001828928.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa M23]
 gi|28056198|gb|AAO28101.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa Temecula1]
 gi|182630878|gb|ACB91654.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa M23]
 gi|307579234|gb|ADN63203.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 185

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 102/168 (60%), Gaps = 5/168 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++ R F+D+RG F + ++++  +  G+   FVQ N S S   G +RGLH+Q P   Q K
Sbjct: 13  VIEPRVFDDARGEFFEVWNAECFEHQGMSSRFVQSNVSISI-YGVLRGLHYQWP-RPQGK 70

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           LV  + G ++D+AVDIRR SP YG WV++ +SA N  Q++IP GFAHGF+ L       Y
Sbjct: 71  LVGVLEGEVYDVAVDIRRGSPHYGRWVAVLLSAKNKRQLWIPEGFAHGFVVLSERAVFNY 130

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
             TD Y  E D+G+ W D  I + WP+     P +S KDQ  PF+ ++
Sbjct: 131 LCTDVYVKEADAGIRWNDAVIGVDWPIA---APLLSAKDQKAPFMEEV 175


>gi|291543267|emb|CBL16376.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ruminococcus sp. 18P13]
          Length = 202

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 97/169 (57%), Gaps = 2/169 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  + I++     DSRG+F +TY+   ++E GL   FVQDN S S   G +RGLHFQ+ 
Sbjct: 12  GIQGLCIIQPAVHGDSRGYFMETYNQNDMQEAGLDIAFVQDNQSCSTK-GVLRGLHFQKQ 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR I G +FD+AVD+R NS TYG W  +E++A N  Q  IP GFAHGF+    
Sbjct: 71  -FPQTKLVRVIRGSVFDVAVDLRSNSATYGKWFGVELTAENKKQFLIPKGFAHGFLVRSE 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
             E  YK  DFY    + G+AW D +I I W +  T   S S     LP
Sbjct: 130 IAEFCYKCDDFYHPGDEGGLAWNDPAIGIDWGVTGTYPGSASGSGYTLP 178


>gi|146278214|ref|YP_001168373.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556455|gb|ABP71068.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 177

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 99/163 (60%), Gaps = 3/163 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAK 67
           +++    ED RGWF +T+  + + + GL   FVQ N S++   GT+RG+H+QR P+A+ K
Sbjct: 13  LIEAEPREDHRGWFERTFCEEEMAKAGLATRFVQHNSSYNHAVGTLRGMHYQRSPHAEVK 72

Query: 68  LVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIY 127
           ++ C  GRI D+ +D+R +SPTY  W   ++ A +  Q+YIP GFAHG++TLE  T V Y
Sbjct: 73  VITCTRGRIHDVIIDLRPDSPTYMKWEGFDLRAGDHRQLYIPEGFAHGYLTLEDATAVSY 132

Query: 128 KVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            V+  Y+   + GV W D +  I W    ++   +SEKD   P
Sbjct: 133 LVSTAYTPGAEGGVRWDDPTFGIAWAGGVSV---ISEKDAAWP 172


>gi|291513885|emb|CBK63095.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Alistipes shahii WAL 8301]
          Length = 187

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 105/182 (57%), Gaps = 4/182 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V +L+   F D+RG+F + +S +   EL     FVQDN S S   G +RGLHFQ+ 
Sbjct: 7   EIPGVVLLEPEVFGDARGYFMERFSQRRFDELVGPVRFVQDNESKS-RYGVVRGLHFQKG 65

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            YAQAKLV  + GR+ D+AVDIRR SPT+G  V+  +   N  Q++IP GFAHGF  L  
Sbjct: 66  EYAQAKLVSVVRGRVLDVAVDIRRGSPTFGRHVAALLDGENKRQLFIPRGFAHGFAVLSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL-LDTILPSVSEKDQNLPFLNQIDSPFE 180
                YK  ++Y+   + G+AW D ++ I W L    IL  +SEKD+  P L      FE
Sbjct: 126 EAVFQYKCDNYYAPGSEGGIAWDDPALAIDWRLPAGEIL--LSEKDRRHPKLADAPELFE 183

Query: 181 YD 182
           YD
Sbjct: 184 YD 185


>gi|83720588|ref|YP_442017.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia thailandensis
           E264]
 gi|167618956|ref|ZP_02387587.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia thailandensis
           Bt4]
 gi|257138200|ref|ZP_05586462.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia thailandensis
           E264]
 gi|83654413|gb|ABC38476.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia thailandensis
           E264]
          Length = 183

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 111/172 (64%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   EL    V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGFFFESFNAREFSELVEPGVEFVQDNHSRS-ARGVLRGLHYQ-IQHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVD+RR+SP +G WV + +SA N  Q+++P GFAHGF+ L  + +
Sbjct: 71  QGKLVRVVDGEVFDVAVDVRRSSPNFGKWVGVRLSAENKRQLWVPAGFAHGFVVLSESAD 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  E +  + W D+ I I WP+     P V+ KD     L++ +
Sbjct: 131 FLYKTTDYWYPEFERSILWSDEQIGIEWPIDRE--PLVAAKDAAGKTLSEAE 180


>gi|261400014|ref|ZP_05986139.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria lactamica ATCC
           23970]
 gi|269210232|gb|EEZ76687.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria lactamica ATCC
           23970]
          Length = 185

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 97/161 (60%), Gaps = 4/161 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++LK + F+D RG+F +T+     KE      FVQ+NHS S   G +RGLH+Q     Q
Sbjct: 11  VKLLKPQVFKDGRGFFMETFRDGWFKENIADRTFVQENHSQS-RKGVLRGLHYQ-TENTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G +FD+AVD+R  SPT+G W    +SA N  Q++IP GFAHGF  L    EV
Sbjct: 69  GKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNRYQLWIPEGFAHGFYVLGDTAEV 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
           +YK TD+Y  E +  + W D +I I WPL     P +S KD
Sbjct: 129 VYKCTDYYKPEAEQVLIWNDPAIGIGWPL--QTAPLLSPKD 167


>gi|167753452|ref|ZP_02425579.1| hypothetical protein ALIPUT_01726 [Alistipes putredinis DSM 17216]
 gi|167658077|gb|EDS02207.1| hypothetical protein ALIPUT_01726 [Alistipes putredinis DSM 17216]
          Length = 190

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 107/181 (59%), Gaps = 6/181 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++ + F D RG+F ++YS +   +      FVQDN S S   G +RGLHFQ+  
Sbjct: 8   IKDVVIIEPQVFGDDRGYFFESYSQQQFDQAVRPVHFVQDNESKS-RRGVLRGLHFQKGA 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
            AQ+KLVR + GR+ D+AVDIRR SPT+G  V++E++A N  Q+++P GFAHGF  L   
Sbjct: 67  AAQSKLVRVVQGRVLDVAVDIRRGSPTFGKHVAVELTAENHRQLFVPRGFAHGFSVLSDE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITW--PLLDTILPSVSEKDQNLPFLNQIDSPFE 180
               YK  +FY+ + +  +AW D  + I W  P  + IL   S KD+  P L   D  F+
Sbjct: 127 AVFQYKCDNFYAPQSEGAIAWNDPDLGIDWQLPAEEAIL---SPKDRAHPRLKDADELFD 183

Query: 181 Y 181
           Y
Sbjct: 184 Y 184


>gi|299140529|ref|ZP_07033667.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella oris C735]
 gi|298577495|gb|EFI49363.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Prevotella oris C735]
          Length = 182

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 105/164 (64%), Gaps = 2/164 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  V I++   F D+RG+F + + ++  ++   +  F+QDN S S   G +RGLH+Q+  
Sbjct: 8   IKGVYIIEPHVFNDARGYFFEAWKNEEFQQYVGKINFIQDNESKS-SYGVLRGLHYQKGE 66

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           Y+QAKLVR I G++ D+AVDIR++SPT+G +V +E+S  N  Q +IP GFAHGF+ L   
Sbjct: 67  YSQAKLVRVIKGKVLDVAVDIRKSSPTFGKYVMVELSDENKRQFFIPRGFAHGFLVLSEE 126

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               YKV + Y+ +H++ + W D+ I I WP ++T     SEKD
Sbjct: 127 AIFTYKVDNVYAPQHEASIRWNDEDIHIEWP-IETKDVLTSEKD 169


>gi|209518632|ref|ZP_03267450.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia sp. H160]
 gi|209500915|gb|EEA00953.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia sp. H160]
          Length = 183

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 102/150 (68%), Gaps = 3/150 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++++   E +G+   FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGFFFESFNAREFAEKVGVDAEFVQDNHSRS-AKGVLRGLHYQ-IQHA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIR++SP +G WV + +S  N  Q+++P GFAHGF+ L  + +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRKSSPNFGKWVGVTLSVENHRQLWVPPGFAHGFVVLSESAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            +YK TD++  EH+  + W D  + I WP+
Sbjct: 131 FLYKTTDYWFPEHERSIIWNDPDVGIEWPI 160


>gi|149925740|ref|ZP_01914004.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Limnobacter sp. MED105]
 gi|149825857|gb|EDM85065.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Limnobacter sp. MED105]
          Length = 185

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 108/176 (61%), Gaps = 9/176 (5%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIR 54
           M  NP     + +L    + D+RG F +++++K  K++ G+Q  FVQ N S S   G +R
Sbjct: 3   MQCNPTPLQGLLLLTPTVYTDARGHFFESFNAKTFKQVAGIQPEFVQTNESLS-KRGVLR 61

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q  P AQ KLVR + G +FD+AVD+R NS T+G W   E+S  N +Q++IP GFAH
Sbjct: 62  GLHWQTAPKAQGKLVRVVHGAVFDVAVDLRENSETFGQWYGCELSDINHVQLWIPPGFAH 121

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQN 168
           GF+TL       Y+VT+ +S EH+  +AW D  ++I WPL       P++S KD+ 
Sbjct: 122 GFLTLTDTAITSYQVTEHHSPEHEHCMAWNDPVLNIEWPLRRAGVATPTLSPKDEQ 177


>gi|209967017|ref|YP_002299932.1| dTDP-4-dehydrorhamnose 3,5-epimerase, putative [Rhodospirillum
           centenum SW]
 gi|209960483|gb|ACJ01120.1| dTDP-4-dehydrorhamnose 3,5-epimerase, putative [Rhodospirillum
           centenum SW]
          Length = 177

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 97/169 (57%), Gaps = 3/169 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  V ++      D RG F++ + +      GL   F Q + SF+   GT+RGLHFQ P
Sbjct: 7   TIPGVTVVDLEPIRDRRGHFARCFCADAFAARGLPTDFPQHSLSFNAVAGTVRGLHFQLP 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
           P+ + KL+RC  G IFD+AVD+R  SPT+  WV +E+SA+ G  +YIP G AHGF TL  
Sbjct: 67  PHGEPKLIRCTRGAIFDVAVDLRPESPTWRQWVGIELSASTGRALYIPPGLAHGFQTLTD 126

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLP 170
            TEV+Y +   +  E   G  W D +  I WPL  T+   +SE+D + P
Sbjct: 127 ETEVLYMMGVRFVPEAARGYRWNDPAFGIDWPLPPTL---ISERDLSFP 172


>gi|77456517|ref|YP_346022.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas fluorescens
           Pf0-1]
 gi|77380520|gb|ABA72033.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Pseudomonas fluorescens
           Pf0-1]
          Length = 193

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 106/172 (61%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I++ + F D RG+F +++++K  ++  GL   FVQDNHS S   G +RGLH+Q     
Sbjct: 23  VLIIEPKVFGDERGFFYESFNAKAFQDATGLDTQFVQDNHSRS-QKGVLRGLHYQLEN-T 80

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR  AG + D+AVDIRR+SP +G WV++ +SA+N  Q+++P GFAHGF+ L    E
Sbjct: 81  QGKLVRVTAGEVLDVAVDIRRSSPHFGKWVAVRLSADNHRQLWVPEGFAHGFVVLSEFAE 140

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD+Y+   +  + W D  + I W L +   P +S KDQ    L   D
Sbjct: 141 FLYKTTDYYNPSSERSIRWDDPDLGIDWQLDEA--PKLSAKDQAAALLKDAD 190


>gi|206561477|ref|YP_002232242.1| dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase [Burkholderia
           cenocepacia J2315]
 gi|198037519|emb|CAR53456.1| dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase [Burkholderia
           cenocepacia J2315]
          Length = 183

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 108/172 (62%), Gaps = 5/172 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ R F D+RG+F ++++ K   E     V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPRVFGDARGFFYESFNGKEFAERVEPGVEFVQDNHSRS-SKGVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIR+NSP +G WV + +S +N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRKNSPNFGKWVGVVLSDDNHRQLWVPPGFAHGFVVLSDAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +YK TD++  EH+  + W D  I I WP+     P ++ KD     L++ D
Sbjct: 131 FLYKTTDYWFPEHERSIVWNDPEIGIEWPI--DFEPLLAVKDAAGKQLSEAD 180


>gi|325527144|gb|EGD04547.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Burkholderia sp. TJI49]
          Length = 183

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 100/150 (66%), Gaps = 3/150 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V+I++ + F D+RG+F ++++ +   E     V FVQDNHS S   G +RGLH+Q   +A
Sbjct: 13  VKIIEPKVFGDARGYFYESFNGREFAEHVEPGVEFVQDNHSRSAK-GVLRGLHYQIQ-HA 70

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVDIR++SP +G WV + +SA+N  Q+++P GFAHGF+ L    +
Sbjct: 71  QGKLVRVVEGEVFDVAVDIRKHSPNFGKWVGVTLSADNHRQLWVPPGFAHGFVVLSEAAQ 130

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
            +YK TD++  EH+  + W D  I I WP+
Sbjct: 131 FLYKTTDYWYPEHERSIVWNDPEIGIEWPI 160


>gi|302875844|ref|YP_003844477.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium cellulovorans
           743B]
 gi|307689277|ref|ZP_07631723.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium cellulovorans
           743B]
 gi|302578701|gb|ADL52713.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Clostridium cellulovorans
           743B]
          Length = 185

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 100/177 (56%), Gaps = 2/177 (1%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           I  + I++   F D RG+F +TY+    KE GL  VFVQDN S S   G +RGLHFQ   
Sbjct: 11  IKDLYIIEPTVFGDHRGYFMETYNYDEFKEAGLDMVFVQDNQSKS-KKGVLRGLHFQ-TK 68

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           + Q KLVR I G ++D+AVD+R  S TYG    + +S  N  Q Y+P GFAHGF+     
Sbjct: 69  FPQGKLVRVIKGEVYDVAVDLREGSETYGKCYGVFLSEENKRQFYVPEGFAHGFLVTSEE 128

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPF 179
            E +YK T+ Y  E + G+ W D  I + WPL       +S+KD+N   L + +  F
Sbjct: 129 AEFVYKCTNLYHPEFEGGILWNDPEIGVEWPLDGIEEVLLSDKDKNAKTLKESNVKF 185


>gi|73667779|ref|YP_303794.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosarcina barkeri str.
           Fusaro]
 gi|72394941|gb|AAZ69214.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Methanosarcina barkeri str.
           Fusaro]
          Length = 183

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 100/154 (64%), Gaps = 2/154 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQD-VFVQDNHSFSFDCGTIRGLHFQR 60
            I  + +L+ + FED RG+F ++Y+ K L  L  ++  FVQDN S S   G IRGLH+Q 
Sbjct: 7   KIKDLYMLEPKVFEDDRGYFLESYNKKTLDSLLEKEYTFVQDNESKS-SYGVIRGLHYQL 65

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
            P++QAKL+R + G+++D+AVD+R+NSPT+  WV +E+SA N  Q  IP GFAHGF  L 
Sbjct: 66  GPFSQAKLIRVVQGKVYDVAVDLRKNSPTFLDWVGVELSAENKRQFLIPKGFAHGFSVLS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPL 154
                 YK  ++Y  E ++G+ + D S++I W +
Sbjct: 126 ETAIFQYKCDEYYHPEAEAGIIYNDSSLNIDWKI 159


>gi|320101333|ref|YP_004176925.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurococcus mucosus DSM
           2162]
 gi|319753685|gb|ADV65443.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Desulfurococcus mucosus DSM
           2162]
          Length = 187

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 106/167 (63%), Gaps = 4/167 (2%)

Query: 15  EDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAG 74
           +D RG+F++ Y   +    G+   FVQ N S S   G +RGLH+Q  P  Q KLV  + G
Sbjct: 23  QDRRGFFTELYKRTVFLSEGIPYSFVQVNMSES-RKGVVRGLHYQLKPMEQGKLVTVLRG 81

Query: 75  RIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYS 134
           RI+D+AVDIR+ SP +G ++ +E+S +N   ++IP GFAHGF  LE NT V+Y VT  YS
Sbjct: 82  RIYDVAVDIRKGSPWFGRYLGVELSEHNKYLLWIPPGFAHGFQALEDNTVVLYMVTKEYS 141

Query: 135 VEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEY 181
            EH+  ++++D  I I WP L+TI   +SEKD+  P L + ++ F Y
Sbjct: 142 PEHERCISYRDPDIGIEWP-LETIF--LSEKDEKCPPLKKAETNFNY 185


>gi|325203205|gb|ADY98658.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Neisseria meningitidis
           M01-240355]
          Length = 179

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 4/161 (2%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           V++LK + F D RG+F +T+     K    +  FVQ+NHS S   G +RGLH+Q     Q
Sbjct: 11  VKLLKPQVFTDGRGFFMETFRDGWFKTQVCERTFVQENHSKS-GKGVLRGLHYQTE-NTQ 68

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            KLVR + G +FD+AVD+R++SPT+G WV   +SA N  Q+++P GFAHGF  L   TE+
Sbjct: 69  GKLVRVVVGEVFDVAVDMRKDSPTFGKWVGEILSAENKRQLWVPEGFAHGFYVLSDTTEL 128

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
            YK TD+Y  E +  + W D ++ I WPL     P++S KD
Sbjct: 129 TYKCTDYYKPEAEHSLIWNDPTVGIDWPLQGE--PNLSPKD 167


>gi|225376959|ref|ZP_03754180.1| hypothetical protein ROSEINA2194_02601 [Roseburia inulinivorans DSM
           16841]
 gi|225211280|gb|EEG93634.1| hypothetical protein ROSEINA2194_02601 [Roseburia inulinivorans DSM
           16841]
          Length = 190

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 103/169 (60%), Gaps = 5/169 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I  +++++   F D+RG+F +TY+    KE G+   FVQDN S S   G +RGLHFQ  
Sbjct: 12  GIAGLKVIEPTVFGDARGYFMETYNYNDFKEAGIDCEFVQDNQSAS-KKGVLRGLHFQIN 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR + G +FD+AVD+R  S T+G W  + +SA N  Q +IP GFAHGF+ L  
Sbjct: 71  -YPQDKLVRVVNGEVFDVAVDLREGSETFGKWFGVTLSAENKKQFFIPKGFAHGFIVLSD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS---VSEKDQ 167
             E  YKVTDFY    + G+ W+D  I + WP+ + +  +   +S+KD+
Sbjct: 130 YAEFCYKVTDFYHPNDEGGLLWKDPEIGVEWPMPEGMTEADLTLSDKDK 178


>gi|224369621|ref|YP_002603785.1| RfbC2 [Desulfobacterium autotrophicum HRM2]
 gi|223692338|gb|ACN15621.1| RfbC2 [Desulfobacterium autotrophicum HRM2]
          Length = 182

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 103/167 (61%), Gaps = 4/167 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
           +NI  V +++ + F D RG+F +T+     K+  +   FVQDNHS S     +RGLH+Q 
Sbjct: 6   LNIPDVILMEPQVFGDHRGFFMETFRDDEFKQKVVHTTFVQDNHSKS-SQNILRGLHYQI 64

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLV+  +G++FD+AVDIR++SP +G W    +SA N   +++P GFAHGF  L
Sbjct: 65  KQP--QGKLVQVTSGKVFDVAVDIRKSSPFFGKWSGATLSAENKKMLWVPPGFAHGFYVL 122

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD 166
               E  YK TD+Y+ EH+  + W D SI I WP++    P +S+KD
Sbjct: 123 SDEAEFTYKCTDYYAPEHERSILWNDPSIAIDWPIIHGASPILSQKD 169


>gi|116071140|ref|ZP_01468409.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein [Synechococcus
           sp. BL107]
 gi|116066545|gb|EAU72302.1| dTDP-4-dehydrorhamnose 3,5-epimerase related protein [Synechococcus
           sp. BL107]
          Length = 196

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLL-KELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           ++  + F D+RGWF +++S +     +G   VF QDNHS S   G +RGLH+Q  P  QA
Sbjct: 19  LMTPKCFGDNRGWFYESWSRRSFDNAVGETVVFSQDNHSRSIQ-GVLRGLHYQLAPEPQA 77

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           K+VR   G IFD+AVDIR +SPT G W+  E+SA N  Q++IP GFAHGF+TL    EV 
Sbjct: 78  KVVRATLGAIFDVAVDIRSSSPTCGAWIGAELSAENKAQLWIPEGFAHGFLTLSAVAEVQ 137

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPL--LDTILPSVSEKDQNLP 170
           YK   F++   +  + W D ++ I WP   L+    S+S KD   P
Sbjct: 138 YKARGFWNKACERALRWDDPTLAIDWPQGELNGNTISLSPKDAEAP 183


>gi|186684649|ref|YP_001867845.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nostoc punctiforme PCC 73102]
 gi|186467101|gb|ACC82902.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Nostoc punctiforme PCC 73102]
          Length = 181

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 107/173 (61%), Gaps = 7/173 (4%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSS-KLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ- 59
            I  V  L+ + F D RG+F + Y+  K  +E G+   FVQDNHS S     +RGLH+Q 
Sbjct: 7   KIPEVLQLEPKVFADDRGFFFEAYNDRKFAQETGIVANFVQDNHSCS-KQNVLRGLHYQI 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
           + P  Q KLVR + G IFD+AVDIR++S T+G WV+ E+SA N   ++IP GFAHGF+ L
Sbjct: 66  QQP--QGKLVRAVVGTIFDVAVDIRKSSTTFGKWVAYELSAENKRLLWIPPGFAHGFLVL 123

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFL 172
               EV+YK TD+Y+ + D  + W D  + I WPL  +  P +S KDQ   +L
Sbjct: 124 SEVAEVLYKATDYYAPQGDRTILWNDPDLAIDWPL--SASPILSAKDQAGKYL 174


>gi|89094080|ref|ZP_01167023.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Oceanospirillum sp. MED92]
 gi|89081555|gb|EAR60784.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Oceanospirillum sp. MED92]
          Length = 178

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (60%), Gaps = 7/171 (4%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  ++I++ R F D RG+F +T+  K    E G+   FVQDNHS S   G +RGLHFQR 
Sbjct: 8   IADLKIIEPRVFGDERGFFLETFQEKRYATEAGISLPFVQDNHSRS-SKGVLRGLHFQRT 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR ++G +FD+AVD+R  S TYG W  +E+SA N  Q ++P GFAHGF+ L  
Sbjct: 67  K-PQGKLVRVVSGSVFDVAVDLRAGSNTYGNWFGVELSAENKKQFWVPPGFAHGFIVLSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKD-QNLPF 171
             +  YK TD+Y    ++ + W D  + + WP L+   P +SEKD Q LP 
Sbjct: 126 RADFEYKCTDYYDPSDEACLKWNDPEVGVVWPDLE---PLLSEKDKQGLPL 173


>gi|159027477|emb|CAO89442.1| rfbC [Microcystis aeruginosa PCC 7806]
          Length = 181

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 104/163 (63%), Gaps = 5/163 (3%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
           V I++ + + D RG+F ++++ K  +E  G+   FVQDNHS S     +RGLH+Q P + 
Sbjct: 11  VLIIEPQVYGDDRGFFLESFNQKDFREKTGVNTTFVQDNHSMSLK-NVLRGLHYQIP-HP 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q KLVR + G +FD+AVD R++SPT+G WVS  +SA N    ++P GFAHGF+ L    E
Sbjct: 69  QGKLVRVVNGSVFDVAVDARQSSPTFGQWVSCVLSAENKRIFWVPEGFAHGFIVLSERAE 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
            +YK T++Y  +++  +AW D  + I WPL   I P +S KDQ
Sbjct: 129 FLYKTTNYYYPQYEKTIAWNDADLGIDWPL--EIPPILSPKDQ 169


>gi|153813189|ref|ZP_01965857.1| hypothetical protein RUMOBE_03605 [Ruminococcus obeum ATCC 29174]
 gi|149830720|gb|EDM85811.1| hypothetical protein RUMOBE_03605 [Ruminococcus obeum ATCC 29174]
          Length = 189

 Score =  140 bits (354), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 101/166 (60%), Gaps = 2/166 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +I  ++++    F D RG+F +TY+    K  G+   FVQDN S S   G +RGLHFQ  
Sbjct: 10  HIEGLKVITPAVFGDERGYFMETYNYNDYKAAGIDMEFVQDNQSSS-RKGVLRGLHFQ-I 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            Y Q KLVR ++G +FD+AVD+R  SPTYG W  + +SA N  Q +IP  FAHGF+ L  
Sbjct: 68  NYPQDKLVRVVSGEVFDVAVDLREGSPTYGQWYGVLLSAENKKQFFIPKNFAHGFVVLSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQ 167
           + E  YK TDFY    + G+A+ D  I + WP+ + +   +S+KDQ
Sbjct: 128 SAEFAYKCTDFYHPNDEGGLAYNDPDIGVEWPIPEGMELILSDKDQ 173


>gi|22297999|ref|NP_681246.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosynechococcus elongatus
           BP-1]
 gi|22294177|dbj|BAC08008.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Thermosynechococcus elongatus
           BP-1]
          Length = 182

 Score =  140 bits (354), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 106/176 (60%), Gaps = 5/176 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSK-LLKELGLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V +L+ + F D RG+F ++Y+ +  +   GL   FVQDNHS S   G +RGLH+Q
Sbjct: 7   LAIADVLLLELQVFRDQRGFFLESYNQRAFMAATGLAVTFVQDNHSAS-QQGVLRGLHYQ 65

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
              + Q KL+R I G+IFD+AVD+RR+SPT G WV   +SA N  Q++IP GFAHGF   
Sbjct: 66  HQ-HPQGKLIRVIEGKIFDVAVDLRRSSPTCGQWVGTWLSAENFQQLWIPPGFAHGFWVQ 124

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
               +V+YK TD+Y    +  + W D ++ I WP+     P +S KDQ     N++
Sbjct: 125 SATAQVLYKTTDYYHPGDEHTLLWNDPTVGIQWPIDSE--PLLSAKDQQGKSFNEL 178


>gi|94264209|ref|ZP_01288005.1| dTDP-4-dehydrorhamnose 3,5-epimerase [delta proteobacterium MLMS-1]
 gi|93455384|gb|EAT05585.1| dTDP-4-dehydrorhamnose 3,5-epimerase [delta proteobacterium MLMS-1]
          Length = 188

 Score =  140 bits (354), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 110/167 (65%), Gaps = 3/167 (1%)

Query: 8   ILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQA 66
           +L+ + + D RG+F +T+   LL E LG +  FVQDN S S   G +RGLH+Q PP+AQ+
Sbjct: 13  LLQPQVWGDERGYFMETFRLDLLTEVLGYRLDFVQDNESKSVR-GVLRGLHYQLPPFAQS 71

Query: 67  KLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVI 126
           KLVR + G ++D+AVDIR +SPT+G  V LE+S  N  Q++IP GFAH F+ L  +    
Sbjct: 72  KLVRVVEGVVWDVAVDIRPSSPTFGRHVGLELSGANKRQLFIPRGFAHAFVVLSDHAFFQ 131

Query: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLN 173
           YKV ++Y+ E D G++ +D ++ I WPL    L  +S+KD +LP L 
Sbjct: 132 YKVDNYYAPECDRGISCRDPALAIDWPLPFEQL-RLSDKDSHLPLLQ 177


>gi|257456603|ref|ZP_05621798.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Treponema vincentii ATCC
           35580]
 gi|257446023|gb|EEV21071.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Treponema vincentii ATCC
           35580]
          Length = 178

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 100/163 (61%), Gaps = 5/163 (3%)

Query: 9   LKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKL 68
           ++ + F D+RG+F +++S +     G+   FVQDN S S   G +RGLHFQ+  Y+Q KL
Sbjct: 16  IQPKVFSDNRGYFFESWSQRDFAAAGITYTFVQDNQSKS-SKGVLRGLHFQKE-YSQGKL 73

Query: 69  VRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYK 128
           VR ++G +FD+AVDIRR S T+G W  + +SA    Q +I  GFAHGF+ L       YK
Sbjct: 74  VRVLSGEVFDVAVDIRRGSATHGKWYGVVLSAERKNQFFISPGFAHGFLVLSDEAVFAYK 133

Query: 129 VTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSV-SEKDQNLP 170
            TDFY  E + G+ W D +I I WP LD  +P + SEKD   P
Sbjct: 134 CTDFYHPEDEGGIMWNDPAIGIEWPKLD--VPYIFSEKDTKYP 174


>gi|209696413|ref|YP_002264344.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Aliivibrio
           salmonicida LFI1238]
 gi|208010367|emb|CAQ80705.1| dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase [Aliivibrio
           salmonicida LFI1238]
          Length = 184

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 106/168 (63%), Gaps = 6/168 (3%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL--GLQDVFVQDNHSFSFDCGTIRGLHFQR 60
           I  V+I++   F D RG+F +T++    +EL  G    FVQDNHS S   G +RGLH+Q 
Sbjct: 8   IPDVKIIEPSVFGDERGFFMETWNQAKFEELVTGKPTRFVQDNHSKS-KKGILRGLHYQT 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
               Q KLVR ++G +FD+AVDIR+ SPT+G WV   +SA N  Q+++P GFAHGF    
Sbjct: 67  EN-TQGKLVRVVSGEVFDVAVDIRKGSPTFGQWVGEYLSAENKRQLWVPKGFAHGFYVTS 125

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQN 168
              E +YK TD+Y+ + +  + W D+S+ I WPL  + +P +SEKD N
Sbjct: 126 DEAEFVYKCTDYYNPKVEISLFWADESLAINWPL--SGIPMLSEKDIN 171


>gi|227824676|ref|ZP_03989508.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidaminococcus sp. D21]
 gi|226905175|gb|EEH91093.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Acidaminococcus sp. D21]
          Length = 203

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 96/160 (60%), Gaps = 2/160 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
            I+ + ++   +  D RG+F +TY+   ++E G+   FVQDN S S   G +RGLHFQ+ 
Sbjct: 12  KIDGLCVITPTQHGDERGYFMETYNEHDMEEAGIHVKFVQDNQSMSTK-GVLRGLHFQKH 70

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR I GR+FD+AVD+R  S TYG W  +E++  N  Q  IP GFAHGF+ L  
Sbjct: 71  -FPQCKLVRVIRGRVFDVAVDLRAQSKTYGKWYGVELTEENKKQFLIPEGFAHGFLVLSD 129

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPS 161
             E  YKV DF+  + + G+AW D  I I WP +  + P 
Sbjct: 130 VAEFCYKVNDFWHPDDEGGLAWNDPEIGIDWPEVGGVYPG 169


>gi|300704901|ref|YP_003746504.1| dtdp-4-dehydrorhamnose 3,5-epimerase [Ralstonia solanacearum
           CFBP2957]
 gi|299072565|emb|CBJ43915.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Ralstonia solanacearum
           CFBP2957]
          Length = 183

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 108/175 (61%), Gaps = 5/175 (2%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           I  V IL+ + F D RG+F ++++++  ++  G++  FVQDNHS S   G +RGLH+Q  
Sbjct: 10  IPEVLILEPKVFGDDRGFFFESFNARTFEQATGVKRTFVQDNHSRS-ARGVLRGLHYQ-I 67

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
            + Q KLVR   G +FD+AVD+R++SPT+G WV + +SA N  Q+++P GFAHGF+    
Sbjct: 68  QHPQGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGVTLSAENKRQLWVPEGFAHGFVVTSD 127

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
             E +YK TD++  EH+  + W D  + I WP   T  P ++ KD     L + D
Sbjct: 128 YAEFLYKTTDYWYAEHERSIVWNDPDLGIEWPAQGT--PILAAKDAAGARLARAD 180


>gi|255536063|ref|YP_003096434.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342259|gb|ACU08372.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Flavobacteriaceae bacterium
           3519-10]
          Length = 181

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition