PSIBLAST alignment of GI: 254780919 and protein with PDB id: 1rtv

>gi|46015557|pdb|1RTV|A Chain A, Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase) Crystal Structure From Pseudomonas Aeruginosa, Apo Structure Length = 184
>gi|112491446|pdb|2IXJ|A Chain A, Rmlc P Aeruginosa Native Length = 184
>gi|118138550|pdb|2IXH|A Chain A, Rmlc P Aeruginosa With Dtdp-Rhamnose Length = 184
>gi|118138551|pdb|2IXH|B Chain B, Rmlc P Aeruginosa With Dtdp-Rhamnose Length = 184
 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 79/178 (44%), Positives = 106/178 (59%), Gaps = 5/178 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 9   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 67

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 68  IRQ-AQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 126

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+        D 
Sbjct: 127 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQD--APLLSEKDRQGKAFADADC 182