PSIBLAST alignment of GI: 254780919 and protein with PDB id: 2b9u

gi|118137319|pdb|2B9U|A Chain A, Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epimerase From Sulfolobus Tokodaii Length = 176
>gi|118137320|pdb|2B9U|C Chain C, Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epimerase From Sulfolobus Tokodaii Length = 176
 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 98/172 (56%), Gaps = 9/172 (5%)

Query: 5   PVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYA 64
            + ++K + F D RG+F + + S+   ++ +    +Q N SFS   G +RGLH+QR P  
Sbjct: 11  GIILIKPKVFPDKRGFFLEVFKSEDFTKMRIP-NVIQTNMSFSRK-GVVRGLHYQRTPKE 68

Query: 65  QAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTE 124
           Q K++    GRI D+AVD+R++SPT+G +V  E++  N   ++IP GFAHGF  LE +  
Sbjct: 69  QGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIV 128

Query: 125 VIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
           + +   + YS  H+  +++      I WP+ +     +S+KD   P L + +
Sbjct: 129 IYFITHNEYSPPHERCISYS----YIDWPIKE---VIISDKDLQCPSLEKAE 173