RPSBLAST alignment of GI: 254780919 and MMDB domain: 1dzr_A_

>1dzr_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-hexulose epimerase; 2.17A {Salmonella typhimurium}Length = 183
 Score =  182 bits (464), Expect = 2e-47
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 8/185 (4%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M +       V IL+ + F D RG+F ++Y+ +  +EL  + V    ++        +RG
Sbjct: 2   MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRG 61

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQR   AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHG
Sbjct: 62  LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG 121

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+TL    E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q 
Sbjct: 122 FVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF--SQLPELSAKDAAAPLLDQA 179

Query: 176 DSPFE 180
               E
Sbjct: 180 L-LTE 183