RPSBLAST alignment of GI: 254780919 and protein with PDBid: 2zkl

>2zkl_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus} Length = 369
 Score = 50.3 bits (119), Expect = 3e-07
 Identities = 15/109 (13%), Positives = 34/109 (31%), Gaps = 10/109 (9%)

Query: 30  LKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPT 89
             E        Q + + S   G  +G H+        +    ++G+       +  +   
Sbjct: 262 FTEFIKTPDRGQVSVNISKP-GITKGNHWHHTKN---EKFLVVSGKGVIRFRHVNDDEI- 316

Query: 90  YGCWVSLEISANNGLQIYIPTGFAHGFMTL-EMNTEVIYKVTDFYSVEH 137
               +   +S +    + IP G+ H    L + +   I  V + +    
Sbjct: 317 ----IEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPNQ 361