RPSBLAST alignment of GI: 254780919 and SCOP domain: d1ep0a_

Alignment
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 183
 Score =  141 bits (355), Expect = 5e-35
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 2/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +++   I++   + D RG+F +T++  + +E GL+  FVQDN S S   G +RGLHFQR 
Sbjct: 8   SLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSV-RGVLRGLHFQRE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G IFD+AVD+R+NS TYG W  + +S  N  + +IP GFAHGF+ L  
Sbjct: 67  K-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              V YK T+ Y  E+DSG+ W D  I I WPL       +SEKD+N   L +  
Sbjct: 126 ECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENP 180

SCOP domain information

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]