RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose
3,5-epimerase [Candidatus Liberibacter asiaticus str. psy62]
         (198 letters)



>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
           {Archaeon Methanobacterium thermoautotrophicum [TaxId:
           145262]}
          Length = 183

 Score =  141 bits (355), Expect = 5e-35
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 2/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +++   I++   + D RG+F +T++  + +E GL+  FVQDN S S   G +RGLHFQR 
Sbjct: 8   SLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSV-RGVLRGLHFQRE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G IFD+AVD+R+NS TYG W  + +S  N  + +IP GFAHGF+ L  
Sbjct: 67  K-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              V YK T+ Y  E+DSG+ W D  I I WPL       +SEKD+N   L +  
Sbjct: 126 ECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENP 180


>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
           {Salmonella typhimurium [TaxId: 90371]}
          Length = 183

 Score =  137 bits (347), Expect = 4e-34
 Identities = 83/174 (47%), Positives = 112/174 (64%), Gaps = 4/174 (2%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDV-FVQDNHSFSFDCGTIRGLHFQR 60
            I  V IL+ + F D RG+F ++Y+ +  +EL  + V FVQDNHS S     +RGLHFQR
Sbjct: 8   AIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKN-VLRGLHFQR 66

Query: 61  PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120
              AQ KLVRC  G +FD+AVDIR+ SPT+G WV + +SA N  Q++IP GFAHGF+TL 
Sbjct: 67  GENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLS 126

Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
              E +YK T++YS   +  + W D++I I WP   + LP +S KD   P L+Q
Sbjct: 127 EYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF--SQLPELSAKDAAAPLLDQ 178


>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase
           RmlC {Pseudomonas aeruginosa [TaxId: 287]}
          Length = 184

 Score =  128 bits (323), Expect = 3e-31
 Identities = 78/182 (42%), Positives = 104/182 (57%), Gaps = 10/182 (5%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           M         V + + R F D RG+F ++Y+ +  +E  G    FVQDNHS S   G +R
Sbjct: 4   MKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSA-RGVLR 62

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           GLH+Q     Q KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAH
Sbjct: 63  GLHYQIRQA-QGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAH 121

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
           GF+ L    E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+       
Sbjct: 122 GFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDA--PLLSEKDRQGKAFAD 179

Query: 175 ID 176
            D
Sbjct: 180 AD 181


>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase
           RmlC {Mycobacterium tuberculosis [TaxId: 1773]}
          Length = 198

 Score =  124 bits (312), Expect = 5e-30
 Identities = 54/182 (29%), Positives = 91/182 (50%), Gaps = 5/182 (2%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M            +      DSRG F +  +    +      + V+  +      G +RG
Sbjct: 1   MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHF + P +QAK V C++G +FD+ VDIR  SPT+G W S+ +   +   IY+  G AHG
Sbjct: 61  LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+ L+ N+ V+Y  +  Y+ + +  +   D ++ + WPL+D   PS+S++D   P    +
Sbjct: 121 FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV 180

Query: 176 DS 177
            +
Sbjct: 181 RA 182


>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW
           {Streptomyces caeruleus [TaxId: 195949]}
          Length = 190

 Score =  118 bits (296), Expect = 4e-28
 Identities = 51/180 (28%), Positives = 77/180 (42%), Gaps = 8/180 (4%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M + P     V  +   +  D RG F   Y      E   + + +   +      G +RG
Sbjct: 1   MRLRPLGIEGVWEITPEQRADPRGVFLDWYHVDRFAEAIGRPLRLAQANLSVSVRGVVRG 60

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           +HF   P  QAK V C+ G +FD+ VD+R  SPTYGCW    +   +   +Y+  G  HG
Sbjct: 61  IHFVDVPPGQAKYVTCVRGAVFDVVVDLRVGSPTYGCWEGTRLDDVSRRAVYLSEGIGHG 120

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F  +     + Y  +  Y    + GV   D  + I WP    +L   S +DQ+   L + 
Sbjct: 121 FCAISDEATLCYLSSGTYDPATEHGVHPLDPELAIDWPTGTPLL---SPRDQDALLLAEA 177


>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase
           RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]}
          Length = 176

 Score =  116 bits (292), Expect = 1e-27
 Identities = 58/171 (33%), Positives = 99/171 (57%), Gaps = 9/171 (5%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
           + ++K + F D RG+F + + S+   ++ + +  +Q N SFS     +RGLH+QR P  Q
Sbjct: 12  IILIKPKVFPDKRGFFLEVFKSEDFTKMRIPN-VIQTNMSFSRKG-VVRGLHYQRTPKEQ 69

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            K++    GRI D+AVD+R++SPT+G +V  E++  N   ++IP GFAHGF  LE +  +
Sbjct: 70  GKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVI 129

Query: 126 IYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
            +   + YS  H+  +++      I WP+ + I+   S+KD   P L + +
Sbjct: 130 YFITHNEYSPPHERCISYS----YIDWPIKEVII---SDKDLQCPSLEKAE 173


>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD
           {Amycolatopsis orientalis [TaxId: 31958]}
          Length = 202

 Score =  112 bits (281), Expect = 2e-26
 Identities = 47/181 (25%), Positives = 77/181 (42%), Gaps = 8/181 (4%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKE-LGLQDVFVQDNHSFSFDCGTIR 54
           M               R F D RG     Y  +   E  G     V          G +R
Sbjct: 1   MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVR 60

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAH 114
           G+H+   P   AK V C  G+  DI +DIR  SPT+G W S+ +   +   +Y+P G  H
Sbjct: 61  GIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGH 120

Query: 115 GFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQ 174
            F+ LE +T + Y ++  Y  + +  ++  D ++ +   +   + P VS++D+    L +
Sbjct: 121 AFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDI--GVEPIVSDRDRVAITLAE 178

Query: 175 I 175
            
Sbjct: 179 A 179


>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
           {Streptococcus suis [TaxId: 1307]}
          Length = 194

 Score = 98.4 bits (244), Expect = 4e-22
 Identities = 47/187 (25%), Positives = 75/187 (40%), Gaps = 15/187 (8%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQD----NHSFSFDCGTIRGLHF 58
           I  +         D+RGWF + +  + +  LG  + F  +    N+        +RGLH 
Sbjct: 15  IPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHA 74

Query: 59  QRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMT 118
           +         +    G          R   T+G      I A+    I++P G A+GF  
Sbjct: 75  EPWDKY----ISVADGGKVLGTWVDLREGETFGNTYQTVIDASK--SIFVPRGVANGFQV 128

Query: 119 LEMNTEVIYKVTDFYSVEHD---SGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           L       Y V D++++E     + V + D S+DI W  L+     VSE D+N PFL  +
Sbjct: 129 LSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEE--AEVSEADENHPFLKDV 186

Query: 176 DSPFEYD 182
               + D
Sbjct: 187 KPLRKED 193


>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase
           FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
          Length = 135

 Score = 60.4 bits (146), Expect = 9e-11
 Identities = 16/129 (12%), Positives = 38/129 (29%), Gaps = 16/129 (12%)

Query: 6   VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQ 65
            +++  +K  DSRG       +K +          +  + F       RG H  +    +
Sbjct: 2   NKVINFKKIIDSRGSLVAIEENKNIPF-----SIKRVYYIFDTKGEEPRGFHAHK----K 52

Query: 66  AKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEV 125
            + V         + +D                  +  + +Y+     H       +  +
Sbjct: 53  LEQVLVCLNGSCRVILDDGNIIQEI-------TLDSPAVGLYVGPAVWHEMHDFSSDCVM 105

Query: 126 IYKVTDFYS 134
           +   +D+Y 
Sbjct: 106 MVLASDYYD 114


>d1lj8a4 c.2.1.6 (A:1-286) Mannitol 2-dehydrogenase {Pseudomonas
           fluorescens [TaxId: 294]}
          Length = 286

 Score = 25.8 bits (56), Expect = 2.4
 Identities = 10/51 (19%), Positives = 19/51 (37%), Gaps = 1/51 (1%)

Query: 119 LEMNTEVIYKVTDFYSVEHDSGVA-WQDKSIDITWPLLDTILPSVSEKDQN 168
           L  N  V  K    ++  H++ +  W    +     ++D I P  S   + 
Sbjct: 192 LPHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAMVDRITPMTSTAHRL 242


>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus
           subtilis [TaxId: 1423]}
          Length = 330

 Score = 24.5 bits (52), Expect = 6.6
 Identities = 6/35 (17%), Positives = 10/35 (28%)

Query: 97  EISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTD 131
                +G    IP G  H +      T ++     
Sbjct: 82  RYLLISGDYANIPAGTPHSYRMQSHRTRLVSYTMK 116


>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus
           japonicus [TaxId: 34381]}
          Length = 348

 Score = 24.4 bits (52), Expect = 7.0
 Identities = 13/82 (15%), Positives = 23/82 (28%), Gaps = 2/82 (2%)

Query: 106 IYIPTGFAHGFMTLEMNTEVIYKVTD--FYSVEHDSGVAWQDKSIDITWPLLDTILPSVS 163
             +P    H F   + +TE+   +    F  + +  G    D +     P       +  
Sbjct: 102 GSVPRNVTHTFQIQDPDTEMTGVIVPGGFEDLFYYLGTNATDTTHTPYIPSSSDSSSTTG 161

Query: 164 EKDQNLPFLNQIDSPFEYDGLP 185
                +  L   D   E    P
Sbjct: 162 PDSSTISTLQSFDVYAELSFTP 183


>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli
           [TaxId: 562]}
          Length = 416

 Score = 24.0 bits (52), Expect = 9.3
 Identities = 9/32 (28%), Positives = 13/32 (40%)

Query: 55  GLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRN 86
            LH  RP    +  V  +      IA +I R+
Sbjct: 282 LLHVSRPVRWDSDHVVLLDDETQAIASEIVRH 313


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.323    0.139    0.434 

Gapped
Lambda     K      H
   0.267   0.0544    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 749,119
Number of extensions: 33474
Number of successful extensions: 73
Number of sequences better than 10.0: 1
Number of HSP's gapped: 61
Number of HSP's successfully gapped: 15
Length of query: 198
Length of database: 2,407,596
Length adjustment: 81
Effective length of query: 117
Effective length of database: 1,295,466
Effective search space: 151569522
Effective search space used: 151569522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.5 bits)